KEGG   Monodelphis domestica (opossum): 100022680Help
Entry
100022680         CDS       T01031                                 

Gene name
GPX2
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00480  Glutathione metabolism
mdo00590  Arachidonic acid metabolism
mdo01100  Metabolic pathways
mdo04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100022680 (GPX2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100022680 (GPX2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    100022680 (GPX2)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100022680 (GPX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 100022680
NCBI-ProteinID: XP_007473103
Position
1
AA seq 190 aa AA seqDB search
MAHIAKSFYDLSATSLEGERIDFNTFRGRAVLIENVASLUGTTTRDYTQLNELQCRFPRR
LVILGFPCNQFGHQENCQNEEILNSLKYVRPGAGFQPNFVLVQKCEVNGQNEHPVFAYLK
DKLPYPDDDPFSLMTDPKHIIWSPVRRSDIAWNFEKFLVGPEGEPFRRYSRSFQTINIEP
DIKRLLKVAI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggctcacatcgccaaatctttctatgacctcagtgctaccagcctggaaggggagagg
attgatttcaacactttccggggtcgggcagtgcttatcgagaatgtggcatccctctga
ggcacgaccacccgggactacacgcagctcaatgagttgcagtgccgcttcccgaggcgc
ctggtgatactcggcttcccctgcaaccagtttgggcatcaggaaaattgtcagaatgaa
gagatcctgaacagtctcaagtatgtccgtcctggggctggcttccagcccaactttgtc
cttgtccagaagtgtgaggtgaatggacaaaatgagcatcctgtctttgcctacctgaag
gataaactcccctaccctgatgatgacccattctccctcatgacagaccccaagcacatc
atatggagtcctgtgcggcgctcagatatcgcctggaactttgagaagttcctcgtgggc
ccagagggtgaaccctttcgccgatatagccgatctttccaaaccatcaatatcgaaccc
gacatcaaacgtctcctcaaagttgccatatag

DBGET integrated database retrieval system