KEGG   Monodelphis domestica (opossum): 100024485
Entry
100024485         CDS       T01031                                 

Gene name
TRHR
Definition
(RefSeq) thyrotropin releasing hormone receptor
  KO
K04282  thyrotropin-releasing hormone receptor
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04020  Calcium signaling pathway
mdo04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100024485 (TRHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100024485 (TRHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mdo04030]
    100024485 (TRHR)
G protein-coupled receptors [BR:mdo04030]
 Rhodopsin family
  Peptide
   Thyrotropin-releasing hormone (TRH)
    100024485 (TRHR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 100024485
NCBI-ProteinID: XP_001369654
Ensembl: ENSMODG00000004935
UniProt: F7AUF1
Position
3
AA seq 396 aa
MENKTGGELNQTQLQARALVALEYQVVTILLVLIICGLGIIGNIMVVLVVMRTKHMRTPT
NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT
IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNMVTYKDATVVSCG
YKVSRSYYSPIYLMDFGIFYVVPMILATVLYGLIARILFLNPIPSDPKDSSKAWRNDLAY
QKKNVNSKTASRCFNSTISSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENW
FLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKKKPSEKPVNYSVALNYSVIKES
DRFSTELEDITVTDTYLATTKVSFDDTCLSSEVTFS
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggaaaataagacaggaggtgaactgaaccagacacaacttcaggcccgagcattggta
gccctagaataccaagtggtcactatcctcttagttctcatcatctgtgggctaggcatc
ataggcaacatcatggtggtcctggtggtaatgagaaccaaacacatgaggaccccaact
aactgttatttggtgagcctagctgtggctgacctaatggtgctggtggctgcaggtctc
cccaacatcactgacagtatctatggctcctgggtctatggctatgtaggatgtctctgt
attacctatctccaatacttaggcattaatgcttcttcttgctccatcacagcatttaca
attgagaggtacatagccatctgccaccccatcaaggcccagtttctctgtaccttttcg
agagccaaaaagatcattatctttgtgtgggctttcacctccatttactgtatgctttgg
tttttcttgcttgacctcaatatggtcacttacaaagatgctactgtagtgtcctgtggc
tacaaggtatctaggagttactactcccccatttatctgatggactttggcatattctat
gtagtaccaatgatactggccactgtcctctatggactcatagctaggatactgttcttg
aatcccattccttcagatcctaaagacagctctaaggcatggaggaatgacctagcctat
caaaagaagaatgtgaactctaaaacagccagcagatgttttaatagcaccatttcttcc
cggaagcaggttaccaagatgctagcagtggttgtgattctatttgcccttttgtggatg
ccctataggaccctggttgtagtcaattcatttctctccagtccttttcaagaaaattgg
ttcttgctgttctgcagaatctgcatttacctcaacagtgctatcaatccagtgatttac
aatctcatgtcccagaaattccgagctgctttcaggaagctctgcaactgcaaaaagaag
ccttcagagaagccagtcaactatagtgtggcccttaactacagtgtcatcaaggagtct
gaccgcttcagcacagagctcgaagatatcacagtcacagacacttatttggccacgacc
aaagtgtcctttgatgatacatgtttgtcttctgaggtaacatttagctga

DBGET integrated database retrieval system