KEGG   Monodelphis domestica (opossum): 100024521Help
Entry
100024521         CDS       T01031                                 

Gene name
CAMK2B
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II beta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04012  ErbB signaling pathway
mdo04020  Calcium signaling pathway
mdo04024  cAMP signaling pathway
mdo04066  HIF-1 signaling pathway
mdo04114  Oocyte meiosis
mdo04217  Necroptosis
mdo04261  Adrenergic signaling in cardiomyocytes
mdo04310  Wnt signaling pathway
mdo04360  Axon guidance
mdo04713  Circadian entrainment
mdo04720  Long-term potentiation
mdo04722  Neurotrophin signaling pathway
mdo04725  Cholinergic synapse
mdo04728  Dopaminergic synapse
mdo04740  Olfactory transduction
mdo04750  Inflammatory mediator regulation of TRP channels
mdo04911  Insulin secretion
mdo04912  GnRH signaling pathway
mdo04916  Melanogenesis
mdo04921  Oxytocin signaling pathway
mdo04922  Glucagon signaling pathway
mdo04925  Aldosterone synthesis and secretion
mdo04934  Cushing syndrome
mdo04971  Gastric acid secretion
mdo05031  Amphetamine addiction
mdo05152  Tuberculosis
mdo05200  Pathways in cancer
mdo05205  Proteoglycans in cancer
mdo05214  Glioma
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100024521 (CAMK2B)
   04310 Wnt signaling pathway
    100024521 (CAMK2B)
   04066 HIF-1 signaling pathway
    100024521 (CAMK2B)
   04020 Calcium signaling pathway
    100024521 (CAMK2B)
   04024 cAMP signaling pathway
    100024521 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100024521 (CAMK2B)
   04217 Necroptosis
    100024521 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100024521 (CAMK2B)
   04922 Glucagon signaling pathway
    100024521 (CAMK2B)
   04912 GnRH signaling pathway
    100024521 (CAMK2B)
   04921 Oxytocin signaling pathway
    100024521 (CAMK2B)
   04916 Melanogenesis
    100024521 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    100024521 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100024521 (CAMK2B)
  09154 Digestive system
   04971 Gastric acid secretion
    100024521 (CAMK2B)
  09156 Nervous system
   04725 Cholinergic synapse
    100024521 (CAMK2B)
   04728 Dopaminergic synapse
    100024521 (CAMK2B)
   04720 Long-term potentiation
    100024521 (CAMK2B)
   04722 Neurotrophin signaling pathway
    100024521 (CAMK2B)
  09157 Sensory system
   04740 Olfactory transduction
    100024521 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    100024521 (CAMK2B)
  09158 Development and regeneration
   04360 Axon guidance
    100024521 (CAMK2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100024521 (CAMK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100024521 (CAMK2B)
   05205 Proteoglycans in cancer
    100024521 (CAMK2B)
  09162 Cancer: specific types
   05214 Glioma
    100024521 (CAMK2B)
  09165 Substance dependence
   05031 Amphetamine addiction
    100024521 (CAMK2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100024521 (CAMK2B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100024521 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdo01001]
    100024521 (CAMK2B)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100024521 (CAMK2B)
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100024521 (CAMK2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr DUF4440 SnoaL_3 SnoaL_2 Pkinase_fungal Kdo SnoaL_4
Motif
Other DBs
NCBI-GeneID: 100024521
NCBI-ProteinID: XP_001370027
Ensembl: ENSMODG00000016162
UniProt: F7G8T0
Position
1
AA seq 671 aa AA seqDB search
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTIAPATMSAAASGATMGLVEQAKSLLNKKADGVKPQTNSTK
NSAGATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSTNTTIEDEDTKVPRISDILSSVR
RGSGPPEAEGPQPAMPQPCPSPSLLSSLPVLSPRISDILSPVRRGSGPLEADGPQPAVPQ
PCPSPTFMSPLPFPSPRISDILSPVRRGSGPPDAEGPQPAVPQSCPSPSLLSPLPTSSRK
QEIIKITEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNS
KPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHF
HCSGAPVAPLQ
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggccactaccgtgacctgcactcgctttacagacgagtatcagctctatgaagacatt
ggcaagggggctttctcagttgtacgacgctgtgtcaaactttgcactggacatgaatat
gcagctaagatcatcaacaccaagaagctctctgcaagagatcaccagaagctggagaga
gaggcccggatctgccgtctcctgaagcattccaacattgttcgtctccatgacagcatt
tccgaggaaggcttccactaccttgtgtttgatctggtcactggtggagagctctttgaa
gacattgtggcaagagagtactacagtgaagctgatgccagtcattgcatccagcagatc
ctggaggctgttctccattgccaccaaatgggggtcgtccacagagacctcaagccagag
aacctcctcttggccagtaagtgcaaaggagccgcagtgaaacttgcagattttggcctg
gccatcgaggtgcagggggaccagcaggcatggtttggttttgcaggcactcctggctac
ctgtccccagaggttctacgcaaagaggcttacggcaagcctgtggatatctgggcttgt
ggtgtgatcctctacattctgctggtgggctaccccccattctgggatgaagaccaacac
aaactttatcagcagatcaaggctggagcttatgatttcccatcccctgagtgggatact
gtcactcctgaagccaaaaaccttatcaaccagatgttaaccatcaaccctgccaaaagg
atcacagctcatgaggccctgaaacacccatgggtctgccaacgctcaaccgtggcctct
atgatgcacaggcaggagactgtggagtgtctgaagaaattcaatgccaggagaaagctc
aagggggcgatccttaccactatgctggcaacacgaaacttctcagtgggcagacagacc
atcgctccggccactatgtcagctgcggcctccggtgccaccatggggttggtggaacaa
gctaagagcttactgaataagaaggccgatggagtcaagccccagacgaacagcaccaaa
aacagcgcgggagccaccagccccaaagggacgctccctcctgctgccctggagcctcaa
accaccgttatccataacccagtggacgggattaaggaatcatcagacagcaccaacacc
actatagaggatgaagacaccaaagtccccaggatctctgatattctaagctcggtgagg
aggggctcagggcccccggaagctgaggggccccagcctgccatgccccagccatgtccg
tctccatctctcctaagctccctgcctgtcctgtcccccaggatctctgacattctaagc
ccagtgaggaggggctcagggcccctggaagccgatgggccacaaccggctgtcccccag
ccttgtccgtctccgactttcatgagccccctgccattcccatcccccaggatctctgac
attctaagcccggtgaggaggggttcagggcccccggacgctgaggggccccagccagct
gtgccccagtcctgtccatctccatctctcctaagccccctgcccacctcgtctcgcaag
caggaaatcatcaagatcacagagcagctgatagaggccgtcaataacggggactttgag
gcctatgcgaaaatctgcgacccaggcctgacctcgtttgaacctgaagctctgggcaac
ctcgtagaagggatggacttccacagattctactttgagaacttgctagccaagaacagc
aaacccatccacaccaccatcctgaacccccacgtgcatgttattggcgaggacgctgcc
tgtatcgcctacatccgtctcacgcagtacattgacgggcagggccgaccccgcaccagc
cagtcagaggagacccgcgtctggcaccgccgtgatggcaagtggcagaatgtccacttc
cactgttcaggtgcacctgtggccccgctgcagtga

DBGET integrated database retrieval system