KEGG   Monodelphis domestica (opossum): 100024859Help
Entry
100024859         CDS       T01031                                 

Gene name
PLA2G4A
Definition
(RefSeq) phospholipase A2 group IVA
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00564  Glycerophospholipid metabolism
mdo00565  Ether lipid metabolism
mdo00590  Arachidonic acid metabolism
mdo00591  Linoleic acid metabolism
mdo00592  alpha-Linolenic acid metabolism
mdo01100  Metabolic pathways
mdo04010  MAPK signaling pathway
mdo04014  Ras signaling pathway
mdo04072  Phospholipase D signaling pathway
mdo04217  Necroptosis
mdo04270  Vascular smooth muscle contraction
mdo04370  VEGF signaling pathway
mdo04611  Platelet activation
mdo04664  Fc epsilon RI signaling pathway
mdo04666  Fc gamma R-mediated phagocytosis
mdo04724  Glutamatergic synapse
mdo04726  Serotonergic synapse
mdo04730  Long-term depression
mdo04750  Inflammatory mediator regulation of TRP channels
mdo04912  GnRH signaling pathway
mdo04913  Ovarian steroidogenesis
mdo04921  Oxytocin signaling pathway
mdo05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100024859 (PLA2G4A)
   00565 Ether lipid metabolism
    100024859 (PLA2G4A)
   00590 Arachidonic acid metabolism
    100024859 (PLA2G4A)
   00591 Linoleic acid metabolism
    100024859 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    100024859 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100024859 (PLA2G4A)
   04010 MAPK signaling pathway
    100024859 (PLA2G4A)
   04370 VEGF signaling pathway
    100024859 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    100024859 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100024859 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100024859 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    100024859 (PLA2G4A)
   04666 Fc gamma R-mediated phagocytosis
    100024859 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100024859 (PLA2G4A)
   04913 Ovarian steroidogenesis
    100024859 (PLA2G4A)
   04921 Oxytocin signaling pathway
    100024859 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100024859 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    100024859 (PLA2G4A)
   04726 Serotonergic synapse
    100024859 (PLA2G4A)
   04730 Long-term depression
    100024859 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100024859 (PLA2G4A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100024859 (PLA2G4A)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100024859 (PLA2G4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 100024859
NCBI-ProteinID: XP_007481036
Ensembl: ENSMODG00000011791
Position
2
AA seq 750 aa AA seqDB search
MSCIDPYQHIIVEHQYSHKFTVNVLRATKVTKGAFGDMLDTPDPYVELFISSTPDSRKRT
RHFNNDVNPVWNETFEFILDPNQENILEITLMDANYVMDETLGTATFPISSMKVGEKKEV
PFIFNEVTEMILEVALEVCSSPDLRFSMALCDQEKIFRQQRKENIKESMKKLLGPKKSEG
LCSARDVPVIAVLGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSSLYSH
PDFPEKGPKEINEELMASVSHNPLLLLTPQKVKRYIESLWKKKSSGQPVTFTDIFGMLIG
ETLINNRMSSTLSSLKEKVNEAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSEFPKNKGSTMEE
ELENITPKHIVSNDSSDSDDESQEPKGTENADAEKEYQNNNQASWVQRMLMALVSDSTLF
NTREGRAGKVHNFMLGLNLNTSYPLSPLRGISTQDSMEEDELDAAVADPDEFERIYEPLD
VKSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKEILLAEKWAKM
NKLPFPKIDPYVFDREGLKECYVFKPKNPDVEKDCPTIIHFVLANINFRDYKAPGIPRET
QEEKDFADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTMNNIDVIKNAIFESIEYR
RQNPSRCSVSLSNIEARRFFNKDSLSKPSA
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgcatagatccctatcagcacattatagtggagcatcagtattcacacaagttc
acggtgaatgtgttaagggccacgaaagtgacaaaaggtgcctttggtgatatgcttgac
actccagatccctatgtggaacttttcatctcctcaactcctgatagcagaaaacggaca
agacacttcaataatgatgtgaaccctgtgtggaatgaaacttttgaatttatcttggac
cctaatcaggaaaacattttggagatcactttaatggatgccaattatgtcatggatgag
acactaggcacagcaacatttcctatttcttctatgaaagtgggggagaagaaagaagtt
ccatttatttttaatgaagtcactgaaatgattttggaagtagcccttgaagtctgctct
tctcctgaccttcgatttagtatggctctgtgtgatcaggaaaaaatctttcgacaacag
cgaaaagaaaatatcaaggagagtatgaagaaactcctgggcccaaagaagagtgaaggc
ctgtgctcagcacgtgatgtgccagtgattgctgtgctgggctcaggtggtgggttccgt
gccatggtgggattttctggtgtgatgaaggcactgtatgaatcaggaattttggattgt
gctacatatgttgctggtctttctggctctacttggtacatgtcatctctatattctcat
cctgatttcccagagaagggaccaaaggaaattaatgaagagctaatggccagtgtcagc
cacaacccccttctgctgctcacaccccagaaagtaaaacgctatattgaatccttatgg
aagaagaaaagctctgggcagccagtcacttttactgacatctttgggatgttaattgga
gaaaccctaatcaacaatagaatgagcagcactctaagtagtttgaaggaaaaagtaaat
gaggcgcagtgtcccttgcccctctttacctgtctccatgtgaaacctgatgtttcagag
ttgatgtttgcagattgggtggaattcagtccatatgagattgggatggctaaatatggc
acatttatggctcctgatttatttggaagcaaattttttatgggtacagttgtgaaaaaa
tatgaagaaaatccccttcacttcttaatgggtgtttggggtagtgcattttctatccta
ttcaacagagtcctgggagtttctgagttccccaaaaataaggggtccaccatggaagaa
gaattagaaaatattacaccaaaacatattgtgagtaatgatagttcagacagtgatgat
gaatcgcaggagcccaaaggcactgaaaatgcagatgcggaaaaggaatatcaaaataat
aaccaagcaagttgggttcagaggatgctaatggccttggtgagtgattcaaccttattc
aacactcgagagggacgtgctgggaaagtacataacttcatgctgggcttgaaccttaat
acctcctatccactatctcctttgagaggcatctctactcaggactctatggaggaggat
gaattggatgctgctgtggcagatcctgatgagtttgagagaatatatgaacccctagat
gtcaaaagtaaaaagatccatgtggtcgatagtgggctcacatttaatctaccatatcct
ctgatcttgaggcctcagagaggtgtggatcttatcatctcctttgatttttctgcaagg
ccaagtgactccagtcctccttttaaggaaattctgcttgctgaaaaatgggctaaaatg
aataagcttccctttcccaaaatcgatccttatgtgtttgatcgagaaggtctgaaggaa
tgttatgtcttcaaacccaaaaatcctgatgtagaaaaagattgcccaaccatcattcat
tttgttctggccaatatcaacttcagggactataaagctccaggaattccaagagaaaca
caggaagagaaagattttgctgactttgatatttttgatgatcctgaatctccattctct
actttcaattttcaatatccaaatcaagcttttaaaaggcttcatgatctaatgcacttc
aatacaatgaataatatagatgtgataaagaatgccatatttgaaagcattgagtacaga
cgacagaacccatctcgttgttcggtttctctcagtaacattgaggcacgaagattcttt
aacaaagactccctaagcaaaccctcagcatag

DBGET integrated database retrieval system