KEGG   Monodelphis domestica (opossum): 100025181Help
Entry
100025181         CDS       T01031                                 

Gene name
CHRNA4
Definition
(RefSeq) cholinergic receptor nicotinic alpha 4 subunit
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04080  Neuroactive ligand-receptor interaction
mdo04725  Cholinergic synapse
mdo05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100025181 (CHRNA4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100025181 (CHRNA4)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    100025181 (CHRNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mdo04040]
    100025181 (CHRNA4)
Ion channels [BR:mdo04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   100025181 (CHRNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Motif
Other DBs
NCBI-GeneID: 100025181
NCBI-ProteinID: XP_001376203
Ensembl: ENSMODG00000016860
UniProt: F6QGI2
Position
1
AA seq 631 aa AA seqDB search
MRLQGPQGSALLLLLLRGLLILGVLLPASGHVETRAHAEERLLKKLFSGYNKWSRPVANI
SDVVLVRFGLSIAQLIDVDEKNQMMTTNMWVKQEWQDYKLRWDPMDYENVTSIRIPSELI
WRPDIVLYNNADGDFAVTHLTKAHLFYDGRIKWTPPAIYKSSCSIDVTFFPFDQQNCTMK
FGSWTYDKAKIDLVSMHSHVDQLDYWESGEWVIISAVGNYNIKKYECCTETYSDITYSFI
IRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPS
TSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSPRTHTMPAWVRRVFLDIIPRLLFM
KRPGVVKDNCRKLVESMHKLAGGPRFWPQPEPNFVTSPSTSPQTPERSPSASFCVHLEDP
VKPQAVCKSPSGQYTVLQRPEPGKGSPCSPPTPHPPLNNSHPSGFSKVRSLSVQQMYSSN
KVEEGSIRCRSRSIQYCSLQEDSSQANNGQSTSSPASLRSQKDEVQPQEKPSPCKCKCKK
VKATPVPDPVTKPRSTKEQHALPMSPALKLAVEGVQYIADHLKAEDTDFSVKEDWKYVAM
VIDRIFLWMFVIVCLLGTVGLFLPPWLAGMI
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgcggctccaggggccccaggggtcggctctgctgctgctgctactgagggggttgctg
atcctaggagttctactgccagcatctggccatgtggagactcgagcccatgctgaggaa
agacttctaaagaaactcttctctggctacaacaagtggtcccgacctgtagccaatatc
tctgatgtggtccttgtccgatttggactgtccattgctcagctcattgatgtggatgaa
aagaaccaaatgatgaccaccaacatgtgggtgaagcaggagtggcaagattacaagctt
cgctgggacccaatggattatgagaatgtaacctcaatccgcatcccctcagagctcatt
tggaggcctgacatcgttctctacaataatgcagatggtgattttgcggtgacccacctg
accaaagcccacctcttctatgatgggaggatcaagtggacaccccctgccatctataag
agctcctgcagcattgatgtcaccttcttcccctttgaccagcaaaattgtaccatgaag
tttggttcctggacctacgacaaagcaaagattgacctggtgagcatgcacagccatgtg
gaccagttggactattgggagagtggcgagtgggtcatcatcagcgccgttggaaattat
aacattaagaagtatgagtgctgtacagaaacttactcagatatcacctactccttcatt
atccgtaggcttcccctcttttacaccatcaacctcatcatcccctgccttctgatttcc
tgcttgaccgtcttggtcttctatttgccatcagattgtggggagaagatcacattgtgc
atttctgtgctattatccttgactgtgttcctactcctcatcactgaaatcatcccatcc
acatccctggtcattcccctgattggggagtacttgctcttcaccatgatctttgtgacg
ttgtccatcatcatcaccgtctttgtgctcaacgtccaccatcgctcgcctcgcacgcac
accatgcctgcatgggtccgaagggtgttcctggatatcatcccccgcttactcttcatg
aaacgccctggtgtggtgaaggacaactgcaggaagctggtggagtccatgcacaaactc
gctggaggtccgaggttctggccgcagccagagcccaactttgttacttcaccttccacc
agcccccaaaccccagaacggtccccctcagcctcattctgtgtccacctggaggatccg
gtcaaaccccaggctgtctgtaagtctccctcaggtcagtacactgtgctgcagcgccct
gagcctgggaagggcagtccctgctctccccccacccctcaccctcctctgaataattcc
catccctctggcttctccaaagtcagatctctaagtgtacagcaaatgtacagctctaat
aaagtggaggaaggaagcatccgctgcaggtcaaggagcatccagtactgctctctccaa
gaggactcttcccaggcaaacaacgggcagtctaccagctccccggcctctttgaggagt
cagaaagatgaagtccaaccccaggagaaaccctccccatgcaagtgtaaatgcaagaag
gtcaaggctacacctgtcccagatccagtgaccaaaccacgcagcaccaaagaacagcat
gccctgcccatgtcaccagccttgaaactcgcagtagagggagttcagtacattgcagac
catttgaaggcagaagacacagatttttcggtgaaagaagactggaagtacgttgccatg
gtcatagacaggatctttctgtggatgtttgtcattgtctgcttgctggggactgtggga
ctcttcctcccaccctggctggctggaatgatctaa

DBGET integrated database retrieval system