KEGG   Monodelphis domestica (opossum): 100025270Help
Entry
100025270         CDS       T01031                                 

Gene name
NCOA1
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04915  Estrogen signaling pathway
mdo04919  Thyroid hormone signaling pathway
mdo05200  Pathways in cancer
mdo05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    100025270 (NCOA1)
   04919 Thyroid hormone signaling pathway
    100025270 (NCOA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100025270 (NCOA1)
   05224 Breast cancer
    100025270 (NCOA1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100025270 (NCOA1)
Chromosome and associated proteins [BR:mdo03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100025270 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_11 DUF1518 NCOA_u2 SRC-1 PAS PAS_3 PAS_9 DUF4927 HLH PAS_4
Motif
Other DBs
NCBI-GeneID: 100025270
NCBI-ProteinID: XP_007476987
Ensembl: ENSMODG00000015907
Position
1
AA seq 1336 aa AA seqDB search
MSGLGDSSTDPSNPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANIGDIDSL
SVKPDKCKILKKTVDQIQQMKRMEQEKTATDDDVQKSDISSSSQGMIEKESLGPLLLEAL
DGFFFVVNREGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIRPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEEGEDFQ
SCLICIARRLPRPAAITGSESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTAFSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHNVLSPQDNTNSGMSLPRINPSVNPSVSPAQSLARSSTLPPSSNNMVTPRVNH
QQSPDLHSNSSNTNSNNSQGSFGCSAGNQVVASIALNQGQAGSQGSNHSLSLNNSPMDST
GITLAQFMSPRRQVNSGLVTRPRMPNNSFSPNISSLSNPIGMVGSACGNPNRTYSNISAA
SLQGINEGPSNSIGFSATSPVLRQLSSQNSPSRMNMLPTKAESKESKEITSILNEMVQSD
NSSNDVKPLDSGLLHSTDKLSEGDNKYSQTSHKLVQLLATTAEQQLRHTDADTSGKDSLS
CSGTSTATSINSSSSGNTCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEHEKKDNGSG
SVNNQVPGNANIKLELEASKKKESKDHQLLRYLLDKDEKDLRAAPTLSLDDVKVKVEKKE
QMDPCNTTPTTLTKPTPEEIKLETQNQFPADLDQFDPLLPTLEKASQLPGLCESERMEGG
GTGVAIKSEILPTALQSTPVRPPPRLNRLPELELSGLDHQFGQPTIDDQVPWTNNTMTAM
NQGPLNKPEDISVNSSLSFDSLCPIVVLFNLKVLNYSSQPYTADTGAEYHLWLFHFLPVF
LQLIHQNRQAILNQFAASAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQ
LIQQQRALLMRQQSFGNSLPPSSGLPVQMGTSRLPQGAPQQFPYPSSYGTNPGTPPTSTS
PFSQLASNPEASLASRNNMVNRGITGNVGGQFGTGINPQMQQSVFQYPGSGLGQQSEPNF
TPSLSPGSPMMSLQIPPSQSPMLQQTQTQPTSGYQSPDMKTWQQGAMGNNNMFSQTQPAP
AQPGVYNNMSITVSMAGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCSEQINDPALRHTGL
YCNQLSSADILKTESDSGAQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGSQKPTSGPQ
NPQAQQKSLLQQLLTE
NT seq 4011 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggagacagttcaacagacccttctaaccctgactcacacaagagaaaa
gggtcaccatgtgacacactggcatcaagcactgaaaagaggcgcagggaacaagaaaat
aaatatttagaagagctggctgaattgctgtctgcaaacattggtgatattgatagcctg
agtgtaaaaccagacaaatgcaagattttgaagaaaacagtcgatcagattcagcaaatg
aaaagaatggaacaagagaaaacagcaactgatgatgacgtccagaaatcagacatctca
tcaagtagtcaaggaatgattgaaaaagaatctttgggaccccttcttttggaggccttg
gatggatttttctttgttgtgaatcgtgaagggagaattgtttttgtgtcagagaatgtg
accagctatttaggttacaatcaggaggaactgatgaataccagtgtctacagcatcctt
catgtgggagatcatgcagaatttgtcaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaggaggcaacaagacgaaatagccatacctttaactgccggatgcta
attcgccctccagatgagccaggcacagagaaccaagaagcttgccagcgatatgaagta
atgcaatgtttcactgtgtcacagccaaaatcaatccaggaagaaggagaagatttccaa
tcatgtttgatttgtattgcacgccgattgcctcgacctgcagctattacgggttcagaa
tcttttatgaccaagcaagatactacaggtaaaatcatctctattgacaccagttccttg
agagctgctggtagaaccggctgggaagatttagtaaggaagtgcatttatgcctttttc
cagcctcaaggcagagagccatcttatgccagacagctgtttcaagaagtgatgactcgt
ggcactgccttcagcccatcctataggttcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgcaaactttgctaccctcaaagtccagacatgcagcctttcatcatggga
attcatatcatcgacagggaacacaatgttctttctcctcaagacaacactaattctgga
atgtcacttcctcgaataaacccttcagtaaatcctagtgtctctcctgcccagagtttg
gcccgatcatctactcttccaccatctagcaacaatatggtgacccctagagtaaaccat
caacaaagtcctgaccttcatagcaacagcagtaatactaattccaacaacagccaaggg
agctttggatgttcagctggaaatcaagtggtagccagtattgccttaaaccagggacag
gctggttcccagggcagtaatcactctttaagcctcaacaattctccaatggatagtaca
ggaattaccttagcacagttcatgtctccaagaagacaagttaactctggattggtaaca
agaccaagaatgcctaacaattctttttctcccaatatttcttcactcagtaatcctatt
ggcatggtaggcagtgcctgtggtaatcctaataggacttattcaaacatctcagcagct
tctttacagggtattaatgaaggacccagtaactccattggcttttctgctacatcgcct
gttctcagacagctgagctcacaaaattctcctagtagaatgaatatgctgccaacaaaa
gcagaatccaaagaaagcaaagaaatcacatccattttgaatgaaatggttcaatctgac
aatagttcaaatgatgttaaaccattggattcaggcctcttgcatagtactgacaaactc
tcagagggagataataaatactctcaaaccagtcataaactagtacagcttttggcaaca
actgctgaacagcagttacggcatacagatgctgatacaagtggcaaagattctttatct
tgctcaggcacctcaactgcaacatctattaactcttcatcttcaggcaacacttgcccc
tcctctcatagttcattgactgagagacacaaaattctacacaggcttttgcaagaaggt
agtccctcggatataactactctatcagtggaacatgagaaaaaggataatggatctggt
tctgtgaataatcaagtgccaggaaacgccaacataaaattagaactggaggcttcaaag
aaaaaggaatcaaaggaccatcaattattgcggtaccttttagataaagatgagaaagac
ttaagagcggctccaaccttgagtctggatgatgtgaaagtgaaagttgaaaagaaagag
caaatggatccttgtaatacaactccaacaacgctgactaaacctactccagaggaaatc
aaattagagacccagaatcagtttccagctgaccttgaccagtttgatccattattgcca
acactggagaaggcatcccagctgccaggcttatgcgagtcagaaagaatggaaggtgga
ggcactggggtggccatcaaatcagagatcctgccaactgcccttcagtccaccccagtt
agacctccccccaggctgaatagattacctgagctcgaattgagtggcctagatcatcag
tttgggcaaccaacaatagatgaccaggtcccatggacaaacaacacgatgactgctatg
aatcaaggacctctgaataaacctgaagatatttcagtgaatagctctctttcttttgat
tcactgtgccccattgtggtacttttcaacttaaaagttctgaattactcatcccaaccc
tatactgctgacactggagccgagtaccacttgtggttatttcattttctccctgtcttt
ctccagttgatacatcaaaatcggcaggctatcttaaaccagtttgcagcgtctgccccc
gttggcattaatatgaggtcaggcatgcaacaacagatcacgccacagcctcccctgaat
gcccagatgttggcacagcgacagagagaactatacagtcaacagcatcggcaaaggcag
ctaatacaacagcagagagctctgttaatgagacagcaaagctttgggaacagcctcccc
ccctcatctggtctcccagttcaaatggggacttctcgtcttcctcagggtgctccacag
caattcccttacccttctagttatggtacaaacccaggaacccctcccacctccactagc
ccattttcacaactggcatcaaatcctgaggcatccttggctagccgaaacaatatggtc
aacagaggtataacagggaatgttggaggacagtttggtactggaatcaatcctcagatg
cagcagagtgtctttcagtatccaggatcaggattaggtcaacaaagtgaacccaatttt
actccgtctctgagccctggcagtcccatgatgtcactgcagattcctccttcccaaagc
cctatgctgcaacaaactcaaactcagcccacttcaggctaccagtcaccagacatgaag
acctggcaacaaggagcaatgggcaataacaacatgttcagtcagacccaacctgcacct
gcacagcctggagtatacaacaacatgagcatcaccgtatccatggcaggaggaaacaca
aatgtccagaacatgaaccctatgatgggccagatgcagatgagttcattgcagatgcca
ggaatgaatacagtgtgttctgagcagataaatgatccagcactgagacacacaggcctt
tactgcaatcagctttcatcagctgacattctcaaaacagaatcagacagcggtgcccag
caggtgcagcaggttcaggtgttcgccgacgtccagtgtacagtgaatctggtaggcggg
gacccttacctgaaccagcctgggcccctgggatctcaaaaacccacatcaggtccgcag
aacccccaggcccagcagaagagcctccttcagcagctactgactgaataa

DBGET integrated database retrieval system