KEGG   Monodelphis domestica (opossum): 100025473
Entry
100025473         CDS       T01031                                 

Gene name
RFX2
Definition
(RefSeq) regulatory factor X2
  KO
K09173  regulatory factor X 1/2/3
Organism
mdo  Monodelphis domestica (opossum)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mdo03000]
    100025473 (RFX2)
Transcription factors [BR:mdo03000]
 Eukaryotic type
  Other basic domains
   RF-X
    100025473 (RFX2)
SSDB
Motif
Pfam: RFX1_trans_act RFX_DNA_binding Pox_D5 DUF2258
Other DBs
NCBI-GeneID: 100025473
NCBI-ProteinID: XP_007489030
Ensembl: ENSMODG00000001398
Position
3
AA seq 697 aa
MQNPEGGSDSATSVALRTSASTQAPVVQPVAASQQVQPVQHVYPTQVQYVEGGDTVYTNG
AIRTAYSYNTEAQIYAPSSAASYFESPGGGAQVTTVASSPSAIPSHSMVGITMDVGGSQI
ISSSGAYLIHGGMDNTRHSLSHTSRSSPATLEMAIENLQKNEGITSHKSSLLNSHLQWLL
DNYETAEGVSLPRSSLYNHYLRHCQEHKLDPVNAASFGKLIRSVFVGLRTRRLGTRGNSK
YHYYGIRLKPDSPLNRLQEDTQYMAMRQQPIHQKQRYRPAQKMDGLGESGSNSNLHATPE
QSVAAQSQHHQQFIDVSHVFPEFPAPDLGSVFLQEGITVNDIKTLQLLYRRHCEATLDVV
MNLQFHYIEKLWLSFWSSKPPSGEGSTALPSSEEEHEVTVIPKDKLITLCKYDPILKWMR
NCDHILYQALVEILIPDVLRPVPSTLTQAIRNFAKSLEGWLTNAMSDFPQQIIQTKVGVV
SAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQCEESVV
QKLEQDFKLTLQQQSSLDQWATWLDNVVTQVLKHHAGSPSFPKAARQFLLKWSFYSSMVI
RDLTLRSAASFGSFHLIRLLYDEYMFYLVEHRVAEATGETPIAVMGEFNDLASLSLTLLD
KDDISDLSSETDTDARGLGEPLVKRERGDPNHSLQDI
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgcagaatccagagggtggatcagattcagcgacctctgtggcactacgtacatcagca
tcaactcaggccccagttgtccagcctgtggcagcctcccagcaggtacaacctgttcag
catgtctatccaacccaggtccagtatgtggaaggaggagatactgtctatactaatgga
gccatacgaaccgcctattcttacaacacagaagctcagatttatgcccctagcagcgct
gcgtcctactttgagtccccaggaggtggcgctcaggtgactactgtggcatcctctcca
tcagcaattccttctcacagtatggtgggcatcaccatggacgttggggggagtcagatc
atctccagctcaggagcctatctcattcatggggggatggataacactagacattctctg
tcccatacttcacgttcatctccagcaacgcttgaaatggcgattgaaaacctacaaaaa
aatgaagggattacatcacacaaaagcagtttactcaacagccatcttcagtggctcctt
gataattatgaaactgctgaaggtgtgagcctcccaagaagttctctgtacaaccattat
cttcggcactgccaggaacacaaactagatcctgtgaatgctgcttcctttggaaaacta
attcggtctgtgtttgttggattgagaaccagaaggttgggaacaagggggaactccaaa
tatcactattatgggattcgtctaaagccagactcaccactgaatcgattacaggaagac
acacaatatatggcaatgaggcagcagccaatacaccagaagcaaagatataggcctgca
cagaagatggatggccttggggaaagtggctccaatagcaatttgcatgccactccagag
caatcggtagctgctcagagccaacaccatcagcagttcatagatgtttcccatgtcttt
ccagagttcccagctcctgatctaggcagtgtattcttacaggaggggatcactgtgaat
gacataaagaccctacaacttctttacagaagacactgtgaggcaactttggatgttgta
atgaatcttcagtttcactacattgagaagctgtggctgtcattctggagttccaaaccc
ccctcaggtgaaggctccactgctctaccttccagtgaagaagaacatgaagtcactgtc
atcccaaaggacaagcttattacactgtgtaaatatgatcctatattaaagtggatgaga
aattgtgatcacatactatatcaggctctggtggagattctcatccctgatgtgctgaga
ccggtgcccagtaccttgacacaggcaattcgaaattttgcaaagagcttggaaggctgg
ttgacaaatgcaatgagtgattttccccagcagatcattcaaacaaaggttggagtagtg
agtgcctttgcacagactctgcggagatacacatccctgaaccacctcgctcaggcagcc
cgggcagtgctccaaaacacttcccagataaaccagatgctcagtgacctaaatcgagta
gacttcgccaatgtgcaggaacaagcctcctgggtgtgccagtgtgaagagagtgtggta
cagaagctggagcaggatttcaagttgactttgcaacagcagagctcattggatcaatgg
gccacttggcttgataatgttgtcacccaagttcttaaacaccatgctggcagccccagt
ttccccaaggcagcaagacagttcctgcttaaatggtccttttatagctccatggtgatt
cgtgatctcaccttgcgcagtgctgccagttttggttcctttcacctgattcgccttctg
tatgatgaatacatgttttatctggttgagcatcgagtcgctgaggcaacaggggagaca
ccaattgctgtaatgggagagttcaatgaccttgcctccctgtcactgacactgctagat
aaagatgacatcagtgatctcagcagtgaaacagacacagatgcccgtggtctgggtgag
cctctggtgaagcgggaacgtggtgatcctaatcactccctacaggacatctag

DBGET integrated database retrieval system