KEGG   Monodelphis domestica (opossum): 100025555Help
Entry
100025555         CDS       T01031                                 

Gene name
CMA1
Definition
(RefSeq) chymase
  KO
K01329  chymase [EC:3.4.21.39]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    100025555 (CMA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mdo01002]
    100025555 (CMA1)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.39  chymase
     100025555 (CMA1)
Peptidases [BR:mdo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100025555 (CMA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 Orbi_VP7 Peptidase_S29 zf-RING_11
Motif
Other DBs
NCBI-GeneID: 100025555
NCBI-ProteinID: XP_001369716
Ensembl: ENSMODG00000002912
UniProt: F6PN48
Position
1
AA seq 246 aa AA seqDB search
MKVLLLLMLAFLLPPGANADDIIGGHESIPHSRPYMAFLEIEKYGEKYHCGGFLIRRDIV
MTAAHCAGDSIKVTLGAHNIRKEESTQQTLDVKHQIPHPEYNSWRILNDIMLLKLEEKVN
LTLAVGPLPIPSELNPIGHGRVCRAAGWGRTGVRAPGSDTLQEVKLRLMDPANCKHYFHF
DQKRQLCVGNPKKIQSAFKGDSGGPLICSGVAQGIVSYGRHDAEPPAVFTRISYYRDWIN
QVLKSN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtccttctcctgctcatgctggcttttcttctgcctcctggggctaatgctgat
gacattattgggggacacgaatcaattccacattcccgcccttacatggcatttctggaa
attgaaaaatatggtgaaaagtaccattgtggtgggttcctaattcggagggacatcgtg
atgaccgcggcccattgtgcaggagattccatcaaagtcacccttggagcacataacatc
agaaaggaagagtcaacccagcagacccttgatgtcaaacatcaaattcctcacccagaa
tacaactcctggaggattctcaatgacatcatgttactgaagctggaagaaaaagtcaac
ctgactttggcagtggggcctctccccattccttcagagctcaatcctattggccatggg
agagtatgtcgagcagctggctggggacggacaggagtaagagctccaggatcagatact
ttacaggaagtgaaactgagactaatggatcctgctaactgcaagcattatttccatttt
gatcagaaacgccagttgtgtgtgggaaaccccaagaaaattcaatcagcattcaaggga
gactctggaggacccctcatttgttctggtgtggcacaaggcattgtctcctatggaaga
catgatgcagaacctcctgcagtcttcactagaatttcctattaccgtgactggatcaat
caagtcctaaaatcaaattag

DBGET integrated database retrieval system