KEGG   Monodelphis domestica (opossum): 100026234
Entry
100026234         CDS       T01031                                 

Symbol
TRIP10
Name
(RefSeq) thyroid hormone receptor interactor 10
  KO
K07196  thyroid hormone receptor interactor 10
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100026234 (TRIP10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mdo04131]
    100026234 (TRIP10)
Membrane trafficking [BR:mdo04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    100026234 (TRIP10)
SSDB
Motif
Pfam: FCH SH3_1 SH3_9 SH3_2 SH3_3 Lzipper-MIP1 SH3_4 DUF481
Other DBs
NCBI-GeneID: 100026234
NCBI-ProteinID: XP_001376917
Ensembl: ENSMODG00000002259
Position
3:444959955..444971813
AA seq 542 aa
MDWGTELWDQFEVIERHTQWGLDLLDKYVKFVKERTEVEQSYAKQLRSLVKKYLPKRSTK
DDPESKFSQQQSFMQVLQELNDFAGQRELVAENLTVQVCLELAKYSQDIKQERKMHFQEG
RRAQQQLENGLKQLENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHVRS
HMAEESKNEYAAQLQRFNRDQAHFYFTEMPQIFDKLQDMDERRTARLGASYGLLSETELQ
VMPIIGKCLEGMKVAAAAVDPKNDSQVLIGLHKSGFTRPGDVEFEDFSQPMTRAPSDSSL
GVPPDGRPDPRGPVRNRPKRWPFGKKNKTVATEDFSHLPPEQRRKKLKQQLEERGRELQK
EIDQREALKKMKDVYEKTPQMGDPASLEPRISETLGNIERLKLEVQKYEMWLAEAENRVL
GNRGDSLGRHGRPPEPPTVAPPDTNNCASDKESPEAPPSDEGTDTSIYTEFEEDFEEEPA
FPIGHCVAVYQFEGSSEGTISMEEGEDLCLMEEDKGDGWTRVRRKQGGEGYVPTSYLRVT
PS
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggattggggcacggagctgtgggaccagtttgaggtgattgaacgccatacacaatgg
ggcctggacctgttagacaagtatgtgaagtttgtgaaggaacggacagaagtggagcag
agctacgccaagcagctcaggagcctggtgaaaaaataccttcccaagagatcgacaaag
gatgaccctgaatccaagttcagccagcagcagtccttcatgcaggttttacaggagctc
aatgactttgcgggccagcgggagctggtggccgagaacctgacggtgcaagtgtgtctg
gagctggccaagtattcacaagacataaagcaggagcggaagatgcatttccaggagggc
cggcgtgcacagcagcagctagagaatggcctcaagcagctggagaatagcaaacggaag
tttgaacgagactgtcgggaggccgagaaggcagctcagacggccgagcggctggaccag
gatatcaatgccaccaaggcggacgtggagaaggcgaagcagcaggcccacgtgcgcagc
cacatggccgaggagagcaagaacgaatatgcagcccagctccagcgcttcaaccgagac
caggcccacttctactttactgagatgccccagatctttgataagctacaggacatggat
gagaggcggacggcccggctcggtgccagctatgggcttctgtcagagacggagctccag
gtcatgcctatcattggtaaatgcctggagggcatgaaggtggctgctgctgctgtggac
cccaagaatgactcccaggtgctcatcggcctgcacaaatctggcttcacacgccccggc
gatgtagagtttgaggacttcagccagcccatgacccgggccccatcagacagcagcctt
ggggtgcctcccgatgggcgccctgacccacgaggtccagtcagaaaccgccccaagcgc
tggccctttggaaagaagaataagacagtggccacagaggatttcagccacctgccccct
gagcagcgaagaaaaaagttgaagcagcaattggaagagcgaggacgggagttacagaaa
gagattgatcagagggaggccctaaagaagatgaaggatgtttacgagaagacgccgcag
atgggtgaccctgccagcctggagccccgcatctctgagacgctgggcaacatcgagcgg
ctcaagctggaggtgcagaagtacgagatgtggctggccgaggcggagaacagagttctg
gggaaccgaggtgacagcctggggcggcatgggcgtccccccgagccccccacagtggct
cccccagacacaaacaactgtgcttctgacaaggagagcccagaggctcccccctcggat
gaggggacggacacttccatctacacagagtttgaggaggactttgaggaggagccagcc
ttccccattggtcactgtgtcgctgtctaccagtttgaagggtccagcgagggcaccatc
tccatggaggaaggcgaggatttgtgcctaatggaggaggataaaggagacgggtggacg
agggtccggcggaaacagggaggcgagggctacgtgcccacctcctacctccgagtcacc
cccagctga

DBGET integrated database retrieval system