KEGG   Monodelphis domestica (gray short-tailed opossum): 100026448
Entry
100026448         CDS       T01031                                 
Symbol
CRYAB
Name
(RefSeq) crystallin alpha B
  KO
K09542  crystallin, alpha B
Organism
mdo  Monodelphis domestica (gray short-tailed opossum)
Pathway
mdo04141  Protein processing in endoplasmic reticulum
mdo04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100026448 (CRYAB)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100026448 (CRYAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mdo03110]
    100026448 (CRYAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdo04147]
    100026448 (CRYAB)
Chaperones and folding catalysts [BR:mdo03110]
 Heat shock proteins
  HSP20
   100026448 (CRYAB)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100026448 (CRYAB)
SSDB
Motif
Pfam: Crystallin HSP20 ArsA_HSP20
Other DBs
NCBI-GeneID: 100026448
NCBI-ProteinID: XP_001371244
Ensembl: ENSMODG00000014453
UniProt: F7ATA8
Position
4:241318676..241322488
AA seq 174 aa
MDIAIHHPWMRRPLFPFHSPSRIFDQFFGEHLLESDLFPTSTALTPFYFRPSFLRTPSWL
ETGLSEMRLEKDKFFVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRK
YRIPADVDPLAITSSLSSDGVLTVNGPRKQAAGPERTIPITREDKPAVTAAPRK
NT seq 525 nt   +upstreamnt  +downstreamnt
atggacatcgccatccatcatccttggatgcgtcgccccttatttcccttccactcgccc
agccgaatctttgaccagttctttggagagcatctgctggagtctgacctcttccctacc
tccactgccctgactcctttctactttcgaccctctttcctgaggacacctagctggctt
gagactggtctctcagagatgcgactggagaaggacaagttcttcgtaaacctggacgtg
aagcatttctccccagaggagctcaaggtcaaagtgctgggtgatgtgattgaagttcat
ggaaagcacgaagagcgccaggacgagcatggcttcatctctcgtgaattccataggaag
tatcggatcccagctgatgtggacccacttgctatcacctcatctctgtcatctgatgga
gtccttactgtgaatggaccaagaaaacaggctgctggccctgaacgcaccattcctatc
actcgcgaggataagcctgctgtcaccgcagccccgcggaaatag

DBGET integrated database retrieval system