KEGG   Monodelphis domestica (opossum): 100027090Help
Entry
100027090         CDS       T01031                                 

Gene name
ITGA8
Definition
(RefSeq) integrin subunit alpha 8
  KO
K06584  integrin alpha 8
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04151  PI3K-Akt signaling pathway
mdo04510  Focal adhesion
mdo04512  ECM-receptor interaction
mdo04514  Cell adhesion molecules (CAMs)
mdo04810  Regulation of actin cytoskeleton
mdo05165  Human papillomavirus infection
mdo05410  Hypertrophic cardiomyopathy (HCM)
mdo05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mdo05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100027090 (ITGA8)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100027090 (ITGA8)
   04514 Cell adhesion molecules (CAMs)
    100027090 (ITGA8)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100027090 (ITGA8)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100027090 (ITGA8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100027090 (ITGA8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100027090 (ITGA8)
   05414 Dilated cardiomyopathy (DCM)
    100027090 (ITGA8)
  Infectious diseases
   05165 Human papillomavirus infection
    100027090 (ITGA8)
Cell adhesion molecules [BR:mdo04515]
 Integrins
  Integrin alpha subunits
   100027090 (ITGA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Motif
Other DBs
NCBI-GeneID: 100027090
NCBI-ProteinID: XP_001377488
Ensembl: ENSMODG00000010054
UniProt: F6TCV7
Position
8
AA seq 1063 aa AA seqDB search
MAQGGPRCPAVGSREQLRAPLWGFWTALGMLCSPVSQAFNLDVDKLTVYSGPEGSYFGYA
VDFHIPDQRTVSILVGAPKANTSQPDIVEGGAVYYCPWPATGDVHCKQIPFDTTNNRKIR
VNGTKEPIEFKSNQWFGATVKAHKGKVVACAPLYHWRTLKATREKDPVGTCYVAIQNFSA
YAEYSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITANIADIIANY
SFKDILRKLTREKQTEVAPASYDDSYLGYSVAAGEFTGDSQQEILAGVPRGAQNFGYVSI
INSTDMTFIQNFTGEQMASYFGYALSVSDVNNDGLDDVLVGAPLFMEREFESSPKEVGQV
YLYLQESPLLFRDAQVLSGTEVFGRFGSAITHLGDLNQDGYNDIAVGAPFAGEAGRGKVF
IYNGNAEGLNQKPSQILNGAWASQAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVVV
YRARPVVTVDAQLLLHPMIINLENKTCQIPSLATLVPCFTLRVCASVEGQSISNTVGLIA
DVQLDSLKQKGAIKRTLFRDNHQSQFVFPLVINQYQSLQCQDFIIYLRDETEFRDKLSPI
NISLNYSLDESTFEEGLAVKPILNFYRESIVNEQAHILVDCGDDNMCIPDLKLSAVPDKE
QLIIGDENHLMLIINARNGGEGAYEAELFVLIPEEADYVGIERNNKALHPLSCEYKMDNV
TRMVVCDLGNPMAAGTNYSLGLRFAVTHLENTNTSIDFDLQIRSSNKDNPDSNSVSLKIN
VTAVAQVEIRGVSHPPQIVLPIHNWEPEEEPHKEEEVGPLVEHIYELHNIGPSTISETLL
TVGWPNSAREEFLLYIFHIQTLGPLQCQTNPAINSLGIKPAASQEDTPALSAFLRNSSIP
HIVRKRHVPVVELHRQSPAKILNCTNIECLRISCVVGRLEGGESAVLKVRSRLWAQTFLQ
RKNDPYSLASIVSFEVKKMPYNEQPAQLPKGNVAIRTSVIWATPNVSFSIPLWVIILAIL
LGLLVLTLLTLALWKCGFFDRARPPQDDMADREQLTNDKVPDA
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggcggcccccgctgcccagcggtggggagccgggagcagctgcgggcgccc
ctctggggcttctggacagccctggggatgctctgctcgcctgtttcccaggcattcaac
ctggacgtggacaagctcactgtgtacagcggtcctgaaggcagctacttcggctacgct
gtggacttccacatacctgaccagcgaacagtgagtatcttggtgggggctcccaaagcc
aacactagccagccggatatagtggaaggtggcgctgtctattactgcccctggccggcc
acgggggatgttcactgtaagcagatcccgttcgacactactaacaatagaaaaattaga
gtcaatggaaccaaggaacctattgaatttaaatcaaatcagtggtttggagcaacagtg
aaagctcataaagggaaagtggtggcctgcgctcctttgtatcactggagaactctcaaa
gctacccgggaaaaggatcctgttggcacttgctacgtagcgattcagaatttcagtgca
tatgcagaatactctccttgtcggaacagcaatgctgatcctgaaggtcaaggttactgt
caagcaggcttcagtttggatttttacaagaatggagatctcatagtgggaggacctggc
agtttttactggcaaggccaggtgattacagccaacattgccgacatcattgccaattac
tcattcaaagatatcctaagaaaattgactcgagaaaagcaaactgaagttgcgccagca
tcctatgatgacagctaccttggatattccgttgctgctggagaatttaccggagattct
cagcaagaaatcctggctggtgttccacgaggtgcacagaattttggatatgtttcaatt
attaattcaacagatatgaccttcattcagaatttcactggggaacagatggcatcttat
tttggatatgctctttctgtatcagatgtcaacaatgatggccttgatgatgtattagtt
ggagcccctctcttcatggagcgtgaatttgagagcagccctaaagaagtgggacaggtt
tacctgtacttgcaagaaagccctttgctcttcagagatgcccaggtcctctcaggaact
gaagtgtttggcagatttggaagtgctattacccatttgggagatctgaatcaagatgga
tacaatgacattgcagttggtgcgccatttgcaggagaagctggaagaggcaaagtcttc
atttacaatgggaatgcagaagggttaaaccagaaaccttcccagattctgaatggagcc
tgggcctcccaggctgtgccatcgggatttggcttcactttgagaggtgattcagacata
gacaagaatgattacccagatttaattgtgggtgcctttggaactggaaaagtggttgtt
tatagagcaagaccagttgtgacagtggacgcccagcttctgctgcacccgatgattata
aaccttgaaaataaaacctgccagatccctagccttgcaacattggtgccttgctttact
ttgagagtgtgtgcatctgtagaaggtcagagcatttcaaatacagtaggtctgatagct
gatgtacagttagattcattgaaacagaagggagccattaagaggaccctcttcagggat
aaccatcagtcacagtttgtcttccctctagtaataaaccagtatcaatcactccaatgc
caagacttcattatttaccttcgagatgaaactgaattccgagataaattatctccaatc
aacattagcttgaattacagtttagatgaatccacttttgaggaaggtcttgctgtcaaa
ccaatactgaacttttaccgggagagcattgttaatgagcaggctcacatcctggtggac
tgtggagatgacaatatgtgcattcctgacttgaaactttcagctgtaccagacaaagag
cagctgatcattggagatgaaaaccacctaatgcttatcataaatgcaaggaatggaggg
gagggtgcctacgaagctgaactctttgtgctgatacctgaggaagcagattatgtcggt
attgaacgcaacaacaaggctctgcacccactgagctgtgagtacaagatggacaatgta
accagaatggtggtgtgtgacctggggaaccctatggcggctggaacaaattattcacta
ggcctccgatttgctgttacccatcttgaaaataccaatacaagcattgactttgatctc
caaatcagaagttccaacaaggataatccagacagcaattctgtgagcttgaaaatcaat
gtcactgctgtggcccaagtagagataagaggagtatcccatccaccacaaattgttctg
cccattcacaattgggaacctgaagaggaaccccacaaagaagaagaagttggaccatta
gtagagcatatttatgagctgcataatatcggacccagtactatcagtgaaacacttcta
actgtgggatggccaaattctgcccgagaggaatttcttctatatattttccatattcag
acccttggaccattgcagtgtcaaacaaaccctgctatcaactcactgggaataaagcca
gcagcctcccaggaggacactcctgccctcagtgcttttctgcgtaattctagcattcct
catattgtcaggaagagacatgtcccagtggtagagcttcacagacaaagtcctgcaaaa
atactgaattgcacgaacattgaatgcttgcgaatctcttgtgtggtcggacgattggaa
ggaggtgagagtgcagtcctgaaagtcagatcacgattatgggcccaaacttttctccag
agaaaaaatgacccctattctcttgcttccattgtgtcatttgaagttaagaagatgcca
tataatgaacagccagcacagcttcctaaaggaaatgtagctattagaacatcagtcatc
tgggcaactccaaatgtctccttctccatcccgttatgggttatcatattggccatactt
cttggactgctggtcctcacccttttgactttagctttatggaagtgtggattctttgac
cgagcaagacctccccaggatgatatggctgacagagagcaattaacaaatgacaaggtt
cctgatgcttga

DBGET integrated database retrieval system