KEGG   Monodelphis domestica (opossum): 100027666Help
Entry
100027666         CDS       T01031                                 

Definition
(RefSeq) arylamine N-acetyltransferase 1-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00232  Caffeine metabolism
mdo00983  Drug metabolism - other enzymes
mdo01100  Metabolic pathways
mdo05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100027666
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100027666
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100027666
Enzymes [BR:mdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     100027666
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2 LBP_M CorC_HlyC
Motif
Other DBs
NCBI-GeneID: 100027666
NCBI-ProteinID: XP_007476187
Ensembl: ENSMODG00000023205
Position
1
AA seq 314 aa AA seqDB search
MGLKESHRRFVLSAPSALAWLVRGNMDIREYFARIGYNRSNEKLDLETLTEVMWHHVQAV
PFENLDIHCGIPIELNLEATYDKIVRRKRGGWCLEGNHLLFWVLTTMGYETIILGGNVYN
SLKRQYSTMVHLLLKVTIGEKAYIVDGAFGRSHQIWQPMELVSGKDQPQIPCIFRLKEEN
GIWYLDQIRRKQFIPNPEFHNSDLLEKNEFRHIYSFTLQSRTIEEFMSANTYLQNSPQSV
FTSKSFCSLQTVDGVYCLVGWTLTHRRFNYKENMDLVEFKILKDEDIEKTLKDIFNISLD
KKLVPKHGDRFFTV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgggtctgaaagaaagtcacagaagatttgttctttcagccccgtcagcattggcttgg
cttgtccgggggaatatggacattagagaatactttgcaaggatcggctataatcgttcc
aatgagaagctggatttagagacattgactgaagtgatgtggcatcatgttcaagcagtg
ccctttgagaacctggacattcactgtggaatacccatagaactaaacttagaggccaca
tatgacaagattgtgaggaggaagagaggtgggtggtgtctagaaggaaatcaccttctc
ttttgggtcttgactacaatggggtatgagaccataattttagggggaaatgtttataat
tccttaaaaaggcagtatagcactatggttcatctgctcctaaaagtcacaattggtgag
aaagcctatatagtggatggggcatttggccgttctcaccaaatatggcagccaatggaa
ctggtttctggaaaggatcaacctcagattccttgcatttttcgtttaaaagaagagaat
ggaatctggtacttggatcaaataagacggaaacaatttattccaaacccagaatttcat
aactctgatctcttagaaaaaaatgaatttcgtcatatctactctttcactcttcagtca
cgtacaatagaagaatttatgtctgcaaatacctaccttcagaattccccccagtctgtg
tttacaagtaagtctttctgttctctgcagacagtagatggagtttattgtttagttggc
tggactcttactcacagaagattcaattacaaggaaaacatggatttggtagagtttaag
attctgaaggatgaagatattgagaagaccctgaaggacatattcaatatttccctcgac
aaaaagcttgtcccaaagcacggtgatagattttttaccgtttag

DBGET integrated database retrieval system