KEGG   Monodelphis domestica (opossum): 100027676Help
Entry
100027676         CDS       T01031                                 

Definition
(RefSeq) T-box-containing protein TBX6L-like
  KO
K10180  T-box protein 6
Organism
mdo  Monodelphis domestica (opossum)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mdo03000]
    100027676
   03019 Messenger RNA biogenesis [BR:mdo03019]
    100027676
Transcription factors [BR:mdo03000]
 Eukaryotic type
  Other transcription factors
   T-box
    100027676
Messenger RNA biogenesis [BR:mdo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100027676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T-box
Motif
Other DBs
NCBI-GeneID: 100027676
NCBI-ProteinID: XP_007490463
Position
3
AA seq 341 aa AA seqDB search
MQVLPEPMAPRGTPAPGPHSPISASLEDVDLWTEFYRVGTEMVITKSGRRMFPQCKIRLS
GLVPYLKYVVLADFVSVDNFRYKWAKDQWEVAGKAEPQLPGRSYIHPDSPAYGSHWMKEP
VSFHKMKLTNNTLDQHGHIILHSMHRYQPRFLVAQADDLFNVCWNLFQVFSFPQTVFISV
TAYQNEQITKLKIDNNPFAKGFREQGRKPRRALRFSPGRGLTKERLRELVSSPEPERSGL
TKEDAADQAEARGGSGPVSSSRFSPLWGPRELNQTEGPPGEAAGTSPGPYPVYRVRVSEP
GRPQITPGRNSEVRAGSGFGPGGSQAPTERLLHTSTPAEGP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcctgcctgagccaatggccccaaggggcacaccagctccgggcccccacagc
cccatctctgcctccctggaggatgtggatctctggaccgagttctatcgggttggcaca
gagatggtcatcaccaaatctggcagacgaatgttcccccagtgcaaaatcaggctctct
ggcttggtcccttacctcaagtacgtggtactggccgactttgtgtctgtggacaacttc
cggtataagtgggccaaagaccagtgggaagtggcgggcaaggctgagcctcagctccct
ggccgctcctacatccacccagactcgccggcctatggcagccactggatgaaggagccc
gtgtccttccacaaaatgaagctcaccaacaacacgctggaccagcatggccacatcatt
ctccattccatgcaccgctaccagccccgcttcctcgtggcccaggctgatgacctcttc
aatgtctgctggaatctcttccaagtctttagcttcccccagacggtcttcatctccgtc
acggcctaccagaatgagcagatcacgaagctcaagatcgacaacaatccctttgcaaaa
ggattccgggaacaagggaggaagccgaggagggccctcagattcagcccaggccggggc
ctgacgaaggagcggctcagggagcttgtgtccagcccggagccagagcggtctggtctg
actaaggaggacgctgcggaccaggctgaggccaggggaggctccgggccggtcagcagc
agcaggttctccccactctgggggccccgggagctgaaccagacagaggggccaccagga
gaagcagcggggaccagccctggcccttaccccgtgtacagagtgcgggtctcggagcca
ggaagaccccagattacccctggaaggaacagtgaggtcagagcagggagcgggtttggc
cctggtgggtcccaggcgcccactgaacgcctgctgcataccagcaccccagccgagggg
ccatag

DBGET integrated database retrieval system