KEGG   Monodelphis domestica (opossum): 100027716
Entry
100027716         CDS       T01031                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
mdo  Monodelphis domestica (opossum)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mdo01009]
    100027716 (AKAP5)
Protein phosphatases and associated proteins [BR:mdo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     100027716 (AKAP5)
SSDB
Motif
Pfam: WSK Calici_coat
Other DBs
NCBI-GeneID: 100027716
NCBI-ProteinID: XP_007473075
Ensembl: ENSMODG00000009460
UniProt: F7FZI4
Position
1
AA seq 454 aa
MQSMETTVAKIQIESKDEKESVEISPQAEEQVEKASMICFKRRRKSVKALKSKNCSERDH
PAAHHPGPCSAKDHTEVEASDQFQSAGGTWASIRRLITRQKRSKSSKKQVPLDAKADPIE
NTEDTKPVKKKTRSKMKIPCIKLSRRKKKCSHSQMTEESECNLKVKEVTDSLDTKIQTGQ
DDTAVKDKLITDISGGSIQGDNVIVPQVSNISSSGENVASIELGADNEPSTIHTAALILE
KTIEKMEEKQVVNLHQESIPEASEVGHQLPQETTEIDDAVAPDEIPPETPATPETQIMEE
TSNSVIEQEPKEKEHENGESGLEKNESNDTTVCFSKSDFNETAMGTKMPQLEESKRMEPI
AIIVTDTEVSEFDVTKSKNVPKKFLISVENEQSEPFSNALSSTGVNDFEGRTSEQYEKLL
METASSLVKNAIQLSVEQLVNEMDSDDNKRNNLI
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgcaaagtatggagaccacagtggcaaaaattcaaatagagagtaaggatgagaaggaa
tctgtagagataagtcctcaggccgaggagcaggttgaaaaagcatccatgatttgtttt
aaaagaagaaggaaatccgtcaaagctttgaagtcaaagaattgttctgaaagagatcac
ccagcagcccatcatccaggtccgtgcagtgccaaggatcacacagaagtggaagcttca
gatcagtttcagtcagcaggggggacctgggcatcaatccgacgcctcatcactcgacag
aaaaggtcaaaatcttcaaagaaacaagtccccttagatgctaaagcagatcctatagaa
aacactgaggacaccaaacctgttaagaaaaagacgcgctccaaaatgaaaatcccctgc
ataaaactttctagacggaagaaaaaatgtagccattcccaaatgactgaagaatctgaa
tgcaatctgaaagttaaggaagttacagacagcttagatacaaagattcaaactggtcag
gatgatacagcagtaaaggataaattaattacagacataagtggaggtagcatccaggga
gacaatgtaattgtgccccaggttagtaacatcagctcttctggggagaatgtggcttcc
atagaacttggagctgataatgaacctagcaccattcatactgcagcattaatccttgaa
aaaactattgagaagatggaagagaaacaggttgtaaaccttcatcaagaaagcatcccc
gaggcttcggaagtgggacaccagctccctcaggagacaacagagatcgatgatgctgtg
gcacccgatgaaatccccccagagacacctgcaacccctgagacacagatcatggaagaa
acatctaacagtgtcatagaacaggaaccaaaagagaaagaacatgaaaatggagaaagt
ggtttagaaaagaatgagtcaaatgacaccacagtatgcttcagcaaatcagatttcaac
gaaactgcaatgggcacaaagatgccccaattggaagaaagcaaaaggatggagccaatt
gccattattgtaacagacactgaagtcagtgaatttgatgtaacgaaatcgaaaaatgtc
cctaaaaagttcttaatatcagtcgaaaatgagcaaagtgagccattctctaatgctctg
tcatccacaggggttaatgattttgagggcagaacttctgagcagtatgagaagctttta
atggaaactgcttcctcacttgtcaagaatgccattcagttgtctgtagaacaactggtg
aatgaaatggattctgatgataacaaaagaaacaatcttatataa

DBGET integrated database retrieval system