KEGG   Monodelphis domestica (opossum): 100027819Help
Entry
100027819         CDS       T01031                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00561  Glycerolipid metabolism
mdo01100  Metabolic pathways
mdo04714  Thermogenesis
mdo04723  Retrograde endocannabinoid signaling
mdo04923  Regulation of lipolysis in adipocytes
Module
mdo_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100027819 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100027819 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    100027819 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    100027819 (MGLL)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100027819 (MGLL)
Peptidases [BR:mdo01002]
 Serine Peptidases
  Family S33
   100027819 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 DLH Peptidase_S9 Abhydrolase_3 PGAP1 Abhydrolase_5 Abhydrolase_2 LIDHydrolase Thioesterase BAAT_C Ser_hydrolase FSH1
Motif
Other DBs
NCBI-GeneID: 100027819
NCBI-ProteinID: XP_001378008
Ensembl: ENSMODG00000007949
UniProt: F7G8U4
Position
6
AA seq 335 aa AA seqDB search
MCIHLNKLLVGFWFFINSTIHSRSTGREKAAKMPEESSPRRTPQNVPYGDLPHLVNADGQ
YLFCRYWKPKVMPRALVFISHGAGEHCGRYDDLAQMLAELDLLVFAHDHVGHGQSEGERM
VVSDFHVFVRDVLLHVDLMQKENSELPIFLLGHSMGGAISILTAAERPNTFSGMVLISPL
VVASPESATTFKVLAAKVLNLVLPNLSLGTIDSSVISRNQTEVDSYNSDPLICHTGLKVC
FGIQLLNAVSRVERALPRLTLPILLLQGSADKLCDSKGAYVLMEAAKSQDKTLKIYEGAY
HVLHKELPEVTSSVFHEIKMWFSHRITTGRSSSKS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtgtattcatttaaataaacttttggttggattttggtttttcatcaactctactatc
cactcccgttctactggccgtgaaaaggctgccaaaatgcccgaggaaagttctcctagg
cgaacaccccagaatgtcccttatggggaccttcctcatctggtcaatgcagatgggcag
tatctcttctgcagatattggaagcccaaagtgatgccaagggccctcgtgtttatctca
catggtgctggggaacactgtggccgctatgatgacttggcccagatgctggctgaactt
gacctgttggtgtttgctcatgaccatgttggccatgggcagagcgaaggtgagaggatg
gttgtgtctgatttccatgttttcgtcagggatgtgttgctccatgtggatctcatgcaa
aaagaaaactctgagcttcccatcttccttctggggcattccatgggaggggccatttca
atcctaactgctgccgaaagaccaaatactttttctggcatggtgttgatttcacctttg
gtggtcgccagtccagaatcagcaacaactttcaaggtccttgctgcaaaagttctcaac
cttgttctccccaacctgtccctggggaccatcgactccagcgtgatttcccgaaatcag
accgaggtggattcctacaattcagatcccctgatctgtcatacagggttgaaggtttgc
tttggcatccagctgctgaatgctgtatcccgtgtggagagggccctccccaggctgaca
ctgccaatcctgctgctgcagggatctgccgacaagctgtgtgacagcaagggggcctac
gtcctcatggaagctgccaaaagccaggacaagaccctgaagatctacgaaggtgcctac
cacgtcctccacaaagaacttcctgaagtgacaagctctgtcttccatgaaataaaaatg
tggttctctcataggataaccacaggaagaagctcttccaaatcctaa

DBGET integrated database retrieval system