KEGG   Monodelphis domestica (opossum): 100028110Help
Entry
100028110         CDS       T01031                                 

Definition
(RefSeq) olfactory guanylyl cyclase GC-D-like
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00230  Purine metabolism
mdo01100  Metabolic pathways
mdo04740  Olfactory transduction
mdo04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100028110
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    100028110
   04740 Olfactory transduction
    100028110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdo01001]
    100028110
Enzymes [BR:mdo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100028110
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   100028110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Pkinase_Tyr Pkinase Guanylate_cyc HNOBA Kinase-like DUF3987
Motif
Other DBs
NCBI-GeneID: 100028110
NCBI-ProteinID: XP_007490993
Position
4
AA seq 957 aa AA seqDB search
MLPSSCQRGPWLTATPEVSLLDHLKRKTPDLLGLTHQGPWRWLLRPFGGFPFSFLRAPWL
VLLSIMLCYLLLGATLSPNKTQDEDAFIVGVLGPWKCDPLFTKALPHMAAQLAILRAKKD
SLLKLGSQLDYMILEEGCNTPQALAAFLSYRGAVATFVGPSNPGYCPAAALLGQNWGKAL
FSWACGAPESGGTLVPILPSTIHVLLAVLRHFGWAHVAVISSHQDVWVDTAQQVTSALRT
HGLPVGPVTFLGPGGQGALGALKQLQDTNRLKVIVMCMHSVLVGGSEQAVLLAQAHALGL
TDGRYIFIPYDVLLYGMPYRNRSYPVLRDGGVLQEAYDAVLTITLESGTTDFDGAFSAAR
KSGEITTDKEPEQVSPLFGTVYDAIFLLANALNRSRKQGSQLSGNHLQNHIMSLDLAGFS
QRIQTDERGNRLVSYVILDTDGQKSQLIPTHLLDTSTQLVQSLGRPIHFPRGEPPPTDSN
CWFDPDTLCTGDEWSLVPLLAVVSVSTVVLGALGLIYLIRTLQFQPGGGPNKIMLTLEDL
TFTHPRLSRRKLTLDTLSNSRSPSDGKSLSSEVQSPGRIHPATPESSNMALYQGDWVWLK
KFKVGTSLELRQSSAKLLKKMRDLKHENVNLCLGFFTDRGVSAIVFEHCCRGSLEDLLKN
EDLRLDWTFKSSLLMDLIKGIRYLHHRGFPHGSLKSRNCVVDGRFVLKVTDHGYLALLER
QRVPRSQPLSEELLWTAPELLRGPEGSWRGTFKGDVYSFAIILQEVLARGPPYCTSGLTA
EEIIRKVVSPPPLYRPKVSPNQGPPECIRLMKQCWSEDPEDRPSLDDIFSQFKSINQGKK
SSVVDSMLRLLEKYSHDLEDLVQARTEELEQEKQKTEKLLSQMLPQSVAEALKAGTTVVP
EYFDQVTIYFSDIVGFTTISALSEPIEVVDLLNDLYTLFDAVLNSHDVYKNCEINIA
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atgttaccctcttcctgtcaaagaggaccctggctgactgcgacacctgaagtctctctc
ttggatcacctgaagagaaagactcccgaccttcttggcctgacccaccagggcccgtgg
cggtggcttctcagaccctttgggggttttcccttcagctttctgagggccccttggctg
gtgttgctcagcatcatgctgtgctatctcctcctgggtgctactctgagccccaacaag
acacaggatgaggacgctttcattgtgggagtgctgggcccgtggaagtgtgaccccctc
ttcaccaaagccctccctcatatggccgcccagctagccatcctgcgggccaagaaagac
tccttgctgaagctgggtagccagctggactacatgattcttgaggagggctgtaatacc
cctcaggccctggctgctttcctctcctatagaggtgctgtggccacctttgtggggccc
tccaatcctggctactgcccagcagcagcacttctgggccagaactggggcaaggccctt
ttctcctgggcatgtggagccccagagtcagggggcacattggtccccatcttgccctct
accatccatgtcctattggctgtcctgcggcactttggctgggctcatgtggccgtcatc
tcctcccaccaggatgtctgggtagacacagcccaacaggttacctctgccctcaggacg
catggcctgcctgtggggcctgtaacctttctggggcctgggggccagggagctctagga
gccctgaagcagcttcaagacacaaatcgattgaaggtgatagtgatgtgcatgcactca
gttcttgttggaggctctgagcaggcagtcctgcttgcccaggctcacgcacttggcctg
actgatggcaggtacatcttcatcccctacgatgtactactttatgggatgccctatcgc
aaccggtcctacccagtgctgagggatggtggtgtccttcaggaagcatacgatgctgtg
ctgaccattactctggagtctggcacaactgactttgatggagccttctcagctgcaagg
aagagtggagaaatcaccactgacaaagagcctgagcaagtgtctccactctttgggact
gtctatgatgccatctttcttctggccaatgctctgaatcgatctcgaaaacaagggagt
caactctcaggaaatcatcttcagaatcacattatgtctctagatctagctggatttagc
cagaggattcagacagatgagaggggaaatagattggtcagctatgtgatcttggacaca
gatggacagaagagccaacttattccaacccatttgctggatacatccactcaattagtg
caatcattgggcaggcctattcactttccacgaggagaacctcctcccacagattccaat
tgttggtttgatccagatactctatgcacaggagatgagtggtccttggttcccctcctg
gctgtggtatcagtatctactgtagtgcttggagctctgggtctcatttacctcatcaga
actcttcagttccagcctggaggaggccccaacaagattatgctgaccttggaagacctc
acttttacccaccctcgactgagccggcggaaactcaccctggacaccctcagcaattcc
cggagcccctcagatggcaagagcctcagttcggaggtccaatctccagggaggatccac
ccagccacaccagagtcttccaacatggccttgtaccagggagactgggtttggctgaag
aagttcaaggttggaacatcccttgagctccgtcaaagctctgcaaagctacttaaaaag
atgagagatctgaaacatgagaatgtgaatctctgtctgggcttctttactgatcgaggt
gtttctgccattgtgtttgagcactgttgccggggcagtttggaggacctgttgaagaac
gaggacctgcggcttgactggactttcaaatcctccctactgatggatttgattaaaggt
atccggtatctccaccatcgggggtttccccatggctccctcaagtctcgaaactgcgtt
gtggatggacgcttcgtgctgaaggtcacagaccatggttatctggcactcttggagagg
cagcgagttcctcgttcccagcccctgtcagaagagttgctgtggactgcaccagaattg
ctcagagggccagaagggtcttggagaggcacctttaagggtgatgtctacagttttgcc
atcattttgcaagaagtgctggctcgggggccaccctactgcacatcaggactcactgca
gaagaaatcatcaggaaggtggtgtctcctcctcccctctaccgcccgaaggtgtctcct
aaccaggggccccctgaatgcatcaggctgatgaaacagtgctggagcgaggatccagaa
gacagacctagcctggacgacatcttcagccaatttaaaagtatcaaccaaggcaagaag
agcagcgtggtagactcaatgctgcggctgctagagaaatattctcatgatctggaggat
ctagtccaggcaaggacggaggaactggagcaggaaaaacagaagacagagaagctgctc
tcccagatgcttccccaatctgtggcagaggcactgaaggctggaaccactgtggtccca
gagtactttgaccaggtaactatctactttagtgatatagttggcttcacgaccatatca
gctctgagtgagcccatcgaggtggtggacctgctcaatgacctctacacactgttcgat
gccgtgctgaacagtcacgatgtgtataagaactgtgaaataaatattgcctga

DBGET integrated database retrieval system