KEGG   Monodelphis domestica (opossum): 100028850Help
Entry
100028850         CDS       T01031                                 

Gene name
ANGPT2
Definition
(RefSeq) angiopoietin 2
  KO
K05466  angiopoietin 2
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04010  MAPK signaling pathway
mdo04014  Ras signaling pathway
mdo04015  Rap1 signaling pathway
mdo04066  HIF-1 signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100028850 (ANGPT2)
   04015 Rap1 signaling pathway
    100028850 (ANGPT2)
   04010 MAPK signaling pathway
    100028850 (ANGPT2)
   04066 HIF-1 signaling pathway
    100028850 (ANGPT2)
   04151 PI3K-Akt signaling pathway
    100028850 (ANGPT2)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100028850 (ANGPT2)
Cytokines and growth factors [BR:mdo04052]
 Growth factors
  Growth factors (RTK binding)
   100028850 (ANGPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C SlyX
Motif
Other DBs
NCBI-GeneID: 100028850
NCBI-ProteinID: XP_007476291
Ensembl: ENSMODG00000012086
Position
1
AA seq 434 aa AA seqDB search
MLQSAFTLHQSFCDCMRGIYLMPTTPSLLLQSKEKLENYIQDNMKKEMVEMQQNAVQNQT
AVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEI
TKLQDKNSFLEKKVLDMEDKHTVQLQSIKDEKDQLQVLVSRQNSIIEELEKQLVTATANN
SVLQKQQHDLMETVHSLLTMITAPNSKNSFVAKEEQIIFRDCAEAFRAGLTTNGIYTLTF
PNSTDEVKAYCDMETSGGGWTVIQKREDGSTDFQRTWKEYKMGFGDPAGEYWLGNELVSQ
LTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGND
FSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGY
SLKATTMMIRPADF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaatctgcattcacactccatcagtccttctgtgattgtatgagagggatttat
ctgatgcccactactccatcccttcttcttcaatcaaaagaaaaacttgagaactatatc
caggacaatatgaagaaagaaatggtagagatgcaacagaatgctgtgcagaaccagact
gcagtaatgattgaaataggaacaaacttattaaatcaaacagctgagcagactcgtaaa
ctaacagatgttgaagcccaagtactgaatcagacaacccgacttgaacttcagcttttg
gaacattctctttccacaaataaactggaaaaacagatcttagatcagaccagtgaaata
accaaacttcaagacaaaaacagtttcctagaaaagaaagtccttgatatggaagacaag
catacagtgcagctacagtcaataaaagatgaaaaagatcagcttcaagtgttagtatcc
agacaaaattccataattgaggaactggaaaaacagttagtgacagctacagcaaacaac
tcagttcttcaaaagcagcagcatgatctgatggagactgtccacagcttgttaactatg
ataacagcaccaaactccaagaactcctttgtggctaaagaagagcaaatcatttttaga
gactgtgctgaggctttcagagcaggccttaccactaatggcatctacacattaactttt
cctaattctactgatgaggtcaaggcatactgtgacatggaaacaagtggaggtggatgg
acagttattcagaagcgggaagatggcagcactgattttcagcgaacttggaaggaatat
aaaatgggatttggtgatcctgctggagaatactggctaggaaatgaacttgtttcccag
ttgactaatcaacaacgttatgtacttaaaatacatcttaaagattgggaaggaaatgag
gcatattcactgtatgaacatttctatctttcaagtgaagaactcaactataggattcac
cttaaaggacttacggggacagcgggcaaaataagcagcataagccaaccaggaaatgat
tttagcacaaaggatgcagacaatgacaaatgtatttgcaaatgttcacaaatgctaaca
ggaggttggtggtttgatgcctgtggtccttccaacctaaatggaatgtactacccacag
cggcagaacacaaacaagtttaatggcatcaagtggtactactggaaaggatcagggtac
tctctcaaagccacaactatgatgattcgaccagcagatttctaa

DBGET integrated database retrieval system