KEGG   Monodelphis domestica (opossum): 100028855
Entry
100028855         CDS       T01031                                 

Gene name
FOXF2
Definition
(RefSeq) forkhead box F2
  KO
K09399  forkhead box protein F
Organism
mdo  Monodelphis domestica (opossum)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mdo03000]
    100028855 (FOXF2)
Transcription factors [BR:mdo03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100028855 (FOXF2)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 100028855
NCBI-ProteinID: XP_001378770
Ensembl: ENSMODG00000008307
UniProt: F7FGY5
Position
3
AA seq 482 aa
MTTEGGQQPQQQQQQQQQQQQQRLPPPPAPLQRPCSPAPGALQSVLMSQPPPSSSSAAAA
AALETTSSSSSSSASSASSSSSSSSSASSAACKNASGSGGSSGSGGGGGGGGGGSGSKKA
SSGLRRPEKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHN
LSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYHRMV
SGLGFGASLLPQGFDFQAPPSAPLGCHGQGGYGGLDMMPGGYDSSAGAPGHSHPHHHHHH
VPHMSPNPGSTYMASCPVTTGAGVGAAGGGGGGGGGGTGGGGGEYGPDSSSSPVPSSPAM
ASAIECHSPYTSPAAHWSPPGSSPYLKQPPALTPTSNPAAPAGLHSSMSSYSLEQSYLHQ
NAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHHQSVCQDIKPC
VM
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgaccaccgagggcgggcagcagcctcagcaacagcagcaacagcagcagcagcaacag
cagcaacgcctgccgcccccgccggcccctctccagcgtccgtgcagcccggcccccggt
gcgctccagtcagtcttgatgagccagccacccccttcctcctcctccgccgctgctgct
gccgccctggagaccacctcttcttcctcctcttcttccgcgtcctccgcttcttcatca
tcttcctcatcctccagcgcttcctccgcggcttgcaagaacgccagcggcagcggaggc
agcagcgggagcggaggaggaggcggagggggcggcgggggcagtggaagcaagaaggcc
agctcgggactgcgtcgcccagagaagcccccgtattcgtacatcgccctcatcgtcatg
gctattcaaagctcgcccagcaagcggctcacactcagcgagatctatcagttcctgcag
gctcgcttccccttcttccgcggagcctaccagggctggaagaattctgtgcgccacaac
ctctcgctcaatgagtgcttcatcaagctccccaaggggctgggccgccctggaaagggc
cactattggaccatcgacccagctagcgagttcatgttcgaggagggctcattccgccgc
cggcctcggggcttcaggcggaagtgccaggcgctcaagcccatgtaccaccgcatggtc
agcgggctgggtttcggtgcctccctcttaccacagggcttcgacttccaggcccccccc
tctgcgcctctcgggtgccatggccaaggtggctacggcggcctcgacatgatgccggga
ggctacgattccagcgccggcgccccgggacactctcaccctcaccaccatcaccaccac
gtcccccatatgtcgcccaacccgggctcgacctatatggccagctgcccggtcaccaca
ggcgctggagttggggcggctggaggaggaggtggtggaggaggaggaggaacgggaggg
ggaggaggagagtacggaccggacagcagcagcagcccggtgccctcatcaccggccatg
gcgagtgcaatagagtgccactcgccctacactagccccgcggctcactggagccctccc
ggttcctcaccttacctcaagcagccgcctgccctgacgcccaccagcaatccggcagcc
cctgccggactccactccagcatgtcttcctactccctggagcagagctacctgcaccaa
aacgctcgcgaggacctctcagtgggactccctcgctaccagcatcattctactccagtg
tgtgacaggaaagatttcgtcctcaatttcaatggcatttcttcttttcatccttcggct
agtggatcatattatcaccaccatcaccatcaaagtgtctgtcaggacattaagccctgt
gtcatgtga

DBGET integrated database retrieval system