KEGG   Monodelphis domestica (opossum): 100029049Help
Entry
100029049         CDS       T01031                                 

Gene name
MAP2K6
Definition
(RefSeq) mitogen-activated protein kinase kinase 6
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04010  MAPK signaling pathway
mdo04015  Rap1 signaling pathway
mdo04218  Cellular senescence
mdo04380  Osteoclast differentiation
mdo04620  Toll-like receptor signaling pathway
mdo04664  Fc epsilon RI signaling pathway
mdo04668  TNF signaling pathway
mdo04750  Inflammatory mediator regulation of TRP channels
mdo04912  GnRH signaling pathway
mdo05014  Amyotrophic lateral sclerosis (ALS)
mdo05145  Toxoplasmosis
mdo05164  Influenza A
mdo05167  Kaposi's sarcoma-associated herpesvirus infection
mdo05169  Epstein-Barr virus infection
mdo05418  Fluid shear stress and atherosclerosis
Module
mdo_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100029049 (MAP2K6)
   04010 MAPK signaling pathway
    100029049 (MAP2K6)
   04668 TNF signaling pathway
    100029049 (MAP2K6)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100029049 (MAP2K6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100029049 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    100029049 (MAP2K6)
  Endocrine system
   04912 GnRH signaling pathway
    100029049 (MAP2K6)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100029049 (MAP2K6)
  Development
   04380 Osteoclast differentiation
    100029049 (MAP2K6)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100029049 (MAP2K6)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100029049 (MAP2K6)
  Infectious diseases
   05164 Influenza A
    100029049 (MAP2K6)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100029049 (MAP2K6)
   05169 Epstein-Barr virus infection
    100029049 (MAP2K6)
   05145 Toxoplasmosis
    100029049 (MAP2K6)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100029049 (MAP2K6)
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: STE group
  STE7 family
   100029049 (MAP2K6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 Choline_kinase DUF4344 APH
Motif
Other DBs
NCBI-GeneID: 100029049
NCBI-ProteinID: XP_007482783
Ensembl: ENSMODG00000006330
Position
2
AA seq 335 aa AA seqDB search
MIVAENCRKRNPGLKIPKEAFEQPQTSSAPPRDLDSKACISIGDKNFEVKADDLEPIAEL
GRGAYGVVEKMRHMPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGAL
FREGDVWICMELMDTSLDKFYKQVIDKGLTIPEDILGKIAVSIVKALEHLHSKLSVIHRD
VKPSNVLINTLGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSD
IWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNS
KERPTYAELMQHQFFTLHESKATDAASFVKLILGD
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgatagtggcagagaactgcaggaagcggaaccctgggttgaagattccaaaggaagca
tttgaacaacctcagaccagctcagcacctcctcgggatttagattccaaggcttgcatc
tcaattggagataagaattttgaagtgaaggctgatgacttggagcctatagcagaactg
ggacgaggtgcatatggggtggtggagaagatgcgacacatgcctagtgggcagatcatg
gcagtgaagcgaatccgagcaactgtgaatagccaggaacagaagaggctactgatggac
ctggatatctccatgaggacagtggattgccctttcacagtcaccttttatggtgcactc
tttcgggagggtgatgtgtggatctgtatggaactcatggatacctcactggataagttc
tacaaacaagtcattgataagggtttaacaatcccagaggacatcttagggaaaattgca
gtttctattgtaaaagccctagaacatttacacagtaaactttctgtcattcatcgagat
gtgaagccatctaatgtattgatcaatacactgggtcaagtgaagatgtgtgattttggt
attagtggttacctggtggactctgtggccaaaactatggatgcaggatgtaaaccctac
atggctcctgaaagaataaatccagaactaaatcagaaggggtacaatgtgaaatctgac
atttggagcctgggcatcacaatgattgaactggcaatccttaggttcccctatgattcc
tgggggacaccatttcagcagctcaagcaggtggtggaagaaccatcacctcaacttcca
gcagacaagttctcagcagagtttgtcgactttacctcacagtgcttgaagaagaattcc
aaagaacggccaacatatgcagaacttatgcaacatcagtttttcactctgcatgaatcc
aaagcaacagatgcagcatcttttgtaaaactgattcttggagactaa

DBGET integrated database retrieval system