KEGG   Monodelphis domestica (opossum): 100029215Help
Entry
100029215         CDS       T01031                                 

Gene name
OTC
Definition
(RefSeq) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00220  Arginine biosynthesis
mdo01100  Metabolic pathways
mdo01230  Biosynthesis of amino acids
Module
mdo_M00029  Urea cycle
mdo_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100029215 (OTC)
Enzymes [BR:mdo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     100029215 (OTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-GeneID: 100029215
NCBI-ProteinID: XP_001379029
Ensembl: ENSMODG00000021104
UniProt: F6UHY3
Position
4
AA seq 354 aa AA seqDB search
MLFNLKTLLRSAALRQQSLLAVRHFQCGKSVQSKVQMKGRHLLTLKDFTGEEIKYLLWLS
ADLKYRIKQKGEYLPLLQGKSLSMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGV
NESLTDTARVLSSMTDAILARVYKHSDLDHLAKEASVPIVNGLSEMYHPVQILADYLTLQ
EHYGYLKGLTLSWIGDGNNILHSIMMSAAKFGMNLQVATPKGYEPDPGITKLAEKYAKEH
GTKLSLTSDPMEAAQGSNVLITDTWISMGQEEEKNKRLQDFQGYQITMKTAGVAAPNWTF
LHCLPRKPEEVDDEVFYCPKSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPTF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttaatttgaagaccttgctgaggagtgcagctctccgacagcaaagcctgctg
gcagttcggcattttcaatgtggaaaatcagtccaaagcaaagttcagatgaaaggacgt
cacctcctaactttaaaagattttacaggagaagaaattaagtatttgctgtggctatca
gcagatctgaagtacagaataaaacaaaaaggagagtatttgcctttgttacaagggaaa
tccctcagcatgatttttgagaaaagaagcaccaggacaagattatccacagaaacggga
tttgctctgcttggaggtcacccttgtttcctgacaacgcaggatattcatttgggagtg
aatgagagtctcaccgacaccgccagggtgctgtctagcatgacagatgcgattctggct
cgagtatataaacactctgatcttgaccacctggccaaagaagcgtcagtaccaatagtc
aatggattgtcagagatgtaccatcctgtccagattctagctgattacctcactctgcag
gaacattatggttacctgaaaggcctcacactcagctggattggtgatgggaacaacatc
cttcactccatcatgatgagtgctgctaaatttggaatgaatctgcaggtggctacgccc
aagggttatgaaccagatcctggtatcaccaaactagcagaaaaatatgccaaagagcat
ggtaccaagctgtctctgacatctgatccaatggaagcagcccaggggagcaatgtctta
attacagacacatggataagcatgggacaagaggaagagaagaacaagagactacaagac
tttcaaggctaccagataacaatgaagacagcaggagtagctgctcccaactggacattt
ttacactgcttgcccagaaaaccagaagaagtggatgatgaagtattttattgtccaaag
tcactggtatttccagaagcagaaaacaggaaatggacaattatggctgtcatggtttcc
ctgctgacagattactcaccacagctgcagaagccgacattttga

DBGET integrated database retrieval system