KEGG   Monodelphis domestica (opossum): 100029588
Entry
100029588         CDS       T01031                                 

Symbol
SCARB1
Name
(RefSeq) scavenger receptor class B member 1
  KO
K13885  scavenger receptor class B, member 1
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04145  Phagosome
mdo04913  Ovarian steroidogenesis
mdo04925  Aldosterone synthesis and secretion
mdo04927  Cortisol synthesis and secretion
mdo04934  Cushing syndrome
mdo04975  Fat digestion and absorption
mdo04976  Bile secretion
mdo04977  Vitamin digestion and absorption
mdo04979  Cholesterol metabolism
mdo05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100029588 (SCARB1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100029588 (SCARB1)
   04925 Aldosterone synthesis and secretion
    100029588 (SCARB1)
   04927 Cortisol synthesis and secretion
    100029588 (SCARB1)
  09154 Digestive system
   04976 Bile secretion
    100029588 (SCARB1)
   04975 Fat digestion and absorption
    100029588 (SCARB1)
   04979 Cholesterol metabolism
    100029588 (SCARB1)
   04977 Vitamin digestion and absorption
    100029588 (SCARB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100029588 (SCARB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100029588 (SCARB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mdo04131]
    100029588 (SCARB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdo04147]
    100029588 (SCARB1)
Membrane trafficking [BR:mdo04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    100029588 (SCARB1)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100029588 (SCARB1)
SSDB
Motif
Pfam: CD36 DUF3899
Other DBs
NCBI-GeneID: 100029588
NCBI-ProteinID: XP_007489696
Ensembl: ENSMODG00000015688
UniProt: A0A5F8G9U5
Position
3:475427917..475525306
AA seq 519 aa
MKHRLRAGPLNTGRSKTKMKQPHGTAKTLVRRAFPVGRPHVGRNEPAKSTVENVRINPSS
LSFEMWKEIPIPFYLSVHLFNVLNPDEVLKGEKPRVEERGPYVYREYRQKQNITFHDNDT
VSFLEYRTFEFQPHMSHGSETDYIVMPNVLVLGSSVMMEHKPMSMKLLMSLSFSMFGQRA
FLNRTVGEIMWGYSDPLIDLLNKYFPGLMPFKDKFGLFAQLNNSNSGLFNVFTGVKDFSK
IHLVDRWNGKTKLNFWNSDQCNMINGTSGQMWAPFMTPDYNLQFYSPEACRSLSFKYEKS
GEFKGIPTFRFVAPDTLFANGSVYPPNEGFCPCLESGIQNMSACQLNAPMFLSQPHFFNA
DPVLVESVTGLHPNKDEHSLFLEVHPVTGIPMNCSVKLQISLYMKSIPGIGQTGKINPVV
LPLVWFEERGAMEGQTLSVFYTRLVLMPKLIQYLQYVLNAVGCLFIIITLILVIRNQGTF
FLFWSSDKKVSKNSEAIQSYSESLMTPAPNGTVLQEARL
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgaaacacagactccgcgccgggcccttaaacactgggcgttcaaagactaaaatgaaa
cagcctcacggaacagcgaaaacattggtgaggcgggcttttcccgtgggtagacctcac
gtgggaagaaatgagccagccaaatctacagtggagaatgtcaggattaaccccagcagc
ctgtccttcgaaatgtggaaggagatcccgattcccttttacttatctgttcacttgttc
aacgtcctcaacccggacgaagtcctcaagggggagaagcccagagtcgaagagcggggg
ccttacgtgtacagagaatacagacagaaacaaaacatcactttccatgacaatgacacg
gtgtccttcttggagtaccggacctttgaattccagcctcacatgtcccatggctcagaa
acggattacattgtgatgccaaacgttttggtcttgggatcctcggtgatgatggagcac
aaacccatgtctatgaagttgctcatgagcctgtcattcagcatgttcggccagcgcgcc
ttcctgaaccgcacggtgggggagatcatgtggggttattcggatcccctcattgatctg
ctgaataaatacttccctggcctgatgccattcaaggataagtttggcttatttgcacag
ttaaacaactccaattcaggattgttcaatgtatttacgggggtcaaagatttcagcaaa
atccatctggtggacaggtggaatggcaagaccaagttaaacttctggaattcagaccag
tgcaatatgattaatgggacatctggacagatgtgggcccctttcatgactccagattat
aaccttcagttctacagcccagaggcttgccggtctttgagttttaaatatgaaaaatca
ggagagttcaaaggcattcctacttttcgatttgtggcccctgacaccttatttgccaat
gggtctgtctaccctccaaatgaaggcttctgtccttgcctggagtcaggaatccagaat
atgagcgcctgccagttaaatgccccgatgttcctttcccagccacatttctttaatgca
gacccggtgctggtcgaatctgtcactgggctccatcccaacaaggatgagcactccctg
ttcctcgaggtgcacccggtcactggcatccccatgaactgctctgtcaagctgcagata
agcctgtacatgaagtccatccctgggatcgggcaaacaggaaaaatcaatccagttgta
ctccctctcgtttggtttgaagagcgaggggcgatggaaggccagacgctcagcgtgttc
tacaccagactggtgttgatgcccaagttgatccagtacctgcagtacgtcttaaatgcc
gtgggctgtctcttcatcatcatcactctcatcttggtcatcaggaatcagggaacattc
tttttattttggagtagtgataaaaaggtctcaaagaattcagaggccattcagtcctat
tctgaatccctgatgacccctgctcctaatgggacagtgctgcaggaagcccgactgtag

DBGET integrated database retrieval system