KEGG   Monodelphis domestica (opossum): 100030014Help
Entry
100030014         CDS       T01031                                 

Gene name
AOX4
Definition
(RefSeq) aldehyde oxidase 4
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00280  Valine, leucine and isoleucine degradation
mdo00350  Tyrosine metabolism
mdo00380  Tryptophan metabolism
mdo00750  Vitamin B6 metabolism
mdo00760  Nicotinate and nicotinamide metabolism
mdo00830  Retinol metabolism
mdo00982  Drug metabolism - cytochrome P450
mdo01100  Metabolic pathways
mdo04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100030014 (AOX4)
   00350 Tyrosine metabolism
    100030014 (AOX4)
   00380 Tryptophan metabolism
    100030014 (AOX4)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100030014 (AOX4)
   00760 Nicotinate and nicotinamide metabolism
    100030014 (AOX4)
   00830 Retinol metabolism
    100030014 (AOX4)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100030014 (AOX4)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100030014 (AOX4)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100030014 (AOX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C CO_deh_flav_C Fer2_2 Fer2 DUF218
Motif
Other DBs
NCBI-GeneID: 100030014
NCBI-ProteinID: NP_001278597
UniProt: M1ZMS0
Position
4
AA seq 1347 aa AA seqDB search
MSSTSSQQSDPLIFFVNGKKVVERHADPEWNLMDYLRRNLSLTGTKYSCGTGDCGACTVM
ISKYNPDTKKIHHYSATACLTSICSLHGTAVTTVEGIGSIKTRIHPVQERLAKCHGTQCG
FCSPGMAMSIYTLLRNHPIPSTEQLMEALGGNLCRCTGYRPILESGKTFCEEPTVCQLQG
TGKCCMDQEENQYSLNKKEEVSHEFHFKFMMCTELYDKSEFQPYDPSQEPIFPPELIRMA
EDPQKKTLYFHGEKVLWISPVSLNELLELRMKYPTAPLVMGNTTVGLNMKVKGEFHPLII
SPIGLPALNFVDFKDDGVTIGAGCSLSEMKEILTHAVSEEPKEKTKTYRALLKHLRTLAG
QQIRNMATLGGHVASKHDYSDINPVLAAGKAILNLISKDGERQILIEELFTTPSLKEELR
PGELIFSVFVPHSRKWEFVFSYRQAQRMENAFAIVNAGMSVHFEEGTNIIQDLKLFFGSV
GPTTVSASKTCKQLIGRQWNDEMLRDGIRMVLEEIFILPTTAGATVKYKKTLTTSFFFIF
YLSVKKELHELEQRYPDIPETSISALEDFPIKIPEGREMFQCVDPHQSPQDPVGHPVMHQ
SGIKHATGEAVYYDDIPQVDKELHLAVVTSTRAHAKILSIDISEALKFPGVVDVITAKDV
PGENNHEGEILYAEDEVICVGQIICSVAADTHAHARQAAEKVKITYEDVEPRIITIEEAI
EHKSFMFEEKKIEKGNVDKAFKHVDEIIEDEVHVGGQEHFYMETQTTLVFPTGEDNEMVI
FIGTQFPTHVQDFTAAALGVPRNKIMCHMKRTGGAFGGKVTKPALLGAIAAVAAHKTGHP
IRFMLERCDDMLITGGRHPILAKFKVGFMKNGKIKAVDIQYFTNAGCTADESEMVLEFIV
LKSENAYDIPNFRCRGRACKTNLPSNTAFRGFGFPQGTLVVENYITAVAIKCGLLPEKVR
DMNMYKTPNTTAYKEPFNPEPLLKCWKQCLEKSSFQSRRTAIEEFNKKNDWKKRGIAIIP
MKFTVGVPHTSESQAASLVHIYQDGSVLVTHGGCELGQGLHTKMIQIASRELKIPSSYIH
LSETSTTTVPNASYTAGSMGTDINGRAVQNACQTLLKRLDPIIKKNPKGKWEDWVSQAFS
ESISLSATGYFRGYKTYMDWEKEVGHPYPYFVYGAGCSEVEIDCLTGAHKLFRTDIFMDA
AFSINPAVDIGQIEGAFIQGMGLYTTEELKYSPEGVLYTRGPDDYKIPTVTEIPEKFYVT
LVHSRNPIAIYSSKGLGEAGMFMGSSVFFAIMDAVGAARRKRGLMEPFTMNSPATPELIR
MSCVDQFTEQIHRDDPSTFKSWSIHVS
NT seq 4044 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctaccagttctcaacaatctgaccctctgattttctttgtgaatgggaaaaag
gtagtagaaagacatgcagatcctgaatggaatctgatggattatttgagaagaaatcta
tccctgacaggaaccaaatatagctgtggaacaggagactgtggagcctgcactgtgatg
atatcaaaatacaacccagacaccaagaagatccaccattattctgctactgcatgcctg
acttccatttgttctctccatggtactgctgtcaccacagtagaaggcattggaagcatc
aaaaccaggattcatccagttcaggagcgacttgccaaatgccatggcactcagtgtgga
ttctgcagcccaggcatggccatgtccatatatactctactgaggaaccatccaattcca
tcaacagagcagttaatggaagctcttggtggtaatctgtgccgatgtactggataccga
ccaattctagaaagtgggaagactttctgtgaggaaccaactgtttgtcaacttcaagga
acaggaaagtgttgcatggatcaagaggaaaaccagtactctctgaataagaaggaagaa
gtaagtcatgaatttcacttcaaatttatgatgtgtactgagctgtatgacaaaagtgaa
ttccagccctatgatccatcccaggagcctatatttccgcctgagctaataaggatggca
gaagatccccaaaagaaaactctttattttcatggagaaaaggttctgtggatttctcct
gtttctctgaatgaacttctggagctaagaatgaagtaccctacagcaccccttgtcatg
ggtaacaccacagtgggactaaatatgaaagttaaaggagaattccaccctcttattatt
tctccaattggacttccagcattaaattttgtggattttaaagatgatggtgtgacaata
ggtgctggatgtagcctgtctgaaatgaaagaaattttgactcatgcagtttcagaggaa
ccaaaagaaaagactaaaacataccgtgctctcttaaagcacttgcgaacgttggcagga
caacagatccggaacatggctactttaggggggcatgtggcaagcaaacatgattattct
gatatcaaccctgttctggcagcaggcaaggccatcctcaatttaatttccaaagatgga
gaacggcaaatcctcatagaagaacttttcacaacaccttctctcaaggaagaacttcgt
cctggagagttaatcttctctgtttttgttccccattccagaaagtgggaatttgtattt
tcctatcgacaagcacagagaatggaaaatgcctttgcaattgttaatgctggaatgagt
gttcattttgaagaaggtacaaacattattcaggaccttaagctgttctttggaagtgtt
ggccctaccacagtctcagcaagtaaaacctgtaagcagctcattgggagacaatggaat
gatgaaatgttgagagacgggatcagaatggtgctggaagagatttttattctacctacc
acagctggagccacggtgaaatataaaaaaaccctgacgaccagtttcttcttcatattc
tatctcagcgtgaaaaaagaactgcatgagctggaacaaagatacccagatatcccagaa
acttccattagtgctctagaagattttcccatcaagattccagagggaagagaaatgttc
cagtgtgtagatccccaccaatctccccaagatccagttggacatccagtcatgcatcag
tcagggattaaacatgccaccggggaggctgtctactatgatgacataccccaagtggac
aaagaacttcacctggctgtggtgaccagtaccagagcacatgcaaaaatcttgtcaatc
gatatttcagaggcccttaaatttccaggtgtcgttgatgtgataactgccaaagatgtc
ccaggagaaaataaccatgaaggagagatattatatgcagaagatgaggtgatttgcgtg
gggcagattatctgttctgtggccgcagatacacatgcccatgcaaggcaagcagctgag
aaagtgaagattacttatgaggatgtagaaccaaggataataaccatagaggaagccata
gagcacaaatcctttatgtttgaagagaagaaaatagaaaaaggaaatgtagacaaagca
tttaaacatgtagatgaaataattgaagatgaagtccatgttggagggcaagaacatttt
tatatggaaacacaaacaactttggttttcccaacaggagaagataatgaaatggtgata
ttcataggaacacagtttccaacccatgttcaggacttcacagctgctgccttgggtgtc
ccaaggaacaagatcatgtgccacatgaaaagaactggtggagcctttggagggaaagtt
accaagcctgccctgctgggagctattgctgcagtggctgctcacaagactggccaccca
attcgtttcatgttggaacgatgtgatgacatgctaataactggtggtcgccacccaata
cttgcaaaatttaaagtaggattcatgaaaaatggcaagatcaaagctgtggatattcag
tattttaccaatgctggatgtacggctgatgagtctgaaatggttttagagttcatagta
ctgaaatctgaaaacgcttatgatattcccaactttcggtgcaggggtagagcctgtaaa
acaaatttgccatccaacacagccttcaggggatttggcttcccacaaggaactttggtg
gttgaaaattacataacagctgtggcaatcaaatgtggtttattaccagaaaaggttagg
gacatgaacatgtacaaaacacctaacacaaccgcttataaagaaccatttaatccagag
ccattgctaaaatgttggaaacagtgtttggagaaatcttcattccagagtaggagaaca
gccatagaagaatttaacaagaaaaatgactggaaaaagcgagggattgctattattccc
atgaaatttacagttggagtccctcatacaagtgaaagtcaggctgcctctctagttcat
atctatcaggatgggtctgtattagtgactcatggtggttgtgaactaggacaaggtctt
cacaccaaaatgattcagattgctagtcgagaactgaaaataccttcatcatatatacac
ctttctgaaacaagcactaccactgtgcccaatgccagctatacagctggatcgatggga
acagacatcaatggaagagcagttcagaatgcttgtcagactcttttgaagcgccttgac
cctatcatcaagaaaaatccaaaaggaaaatgggaagactgggtttctcaagctttctca
gaatccatcagtctgtcagctactggatatttcaggggctacaagacatatatggattgg
gagaaagaagtaggtcatccatatccttattttgtttatggagcaggctgttctgaagtt
gagattgactgcctgactggggctcataagcttttcagaactgacatcttcatggatgct
gctttcagtataaatcctgctgttgacataggacagattgaaggtgcatttattcaaggc
atgggattgtatacaactgaagaactgaagtactccccagaaggtgttctttacactagg
ggtccagatgattataaaatccctacagttactgaaattccagaaaaattctatgtcact
ttggtgcattcccgcaaccccatagccatatactcatccaagggcctaggagaggctgga
atgttcatgggatcatctgtgttctttgctatcatggatgctgtgggtgcagcacgaagg
aagagaggacttatggagcctttcactatgaatagcccagcaactcctgagctgattaga
atgtcttgtgtggatcagtttactgaacagattcatagagatgacccttcaactttcaaa
tcttggtctattcatgtttcctaa

DBGET integrated database retrieval system