KEGG   Monodelphis domestica (opossum): 100030557
Entry
100030557         CDS       T01031                                 

Gene name
TM7SF2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00100  Steroid biosynthesis
mdo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100030557 (TM7SF2)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     100030557 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 100030557
NCBI-ProteinID: XP_001380035
Ensembl: ENSMODG00000010108
UniProt: F6X4J5
Position
8
AA seq 421 aa
MAQQQTAPSPAELEFGGPLGTAALLLLLPLTLFHLLLTCHSGPCSLLSLPPELPPLSAFW
SSGALLLLLFWLGFQATLYLLPMGQVTEGRMLRDKSHLQYPLNGFRCLGLTALLVGLGLA
GGLPLGNLSEMLLPLASAATVTAFFLSLFLYLKSFTVPPSALAPGGNSGNPVYDFFLGRE
LNPRFGSFDLKYFCELRPGLMGWALINLALLLREAERQRGWPSLAMGLVSAFQFIYVADA
LWYEEAVLTTIDIIHDGFGFMLAFGDLVWVPFIYSLQAQFLLNHPQALDLPVAGAICLLK
VIGYVIFRGANSQKNTFRRNPSDPSVAGLETIPTATGRHLLVSGWWGLVRHPNYLGDLIM
ALAWSLPCGVTHLLPYFYFFYFVILLVHREYRDERQCLQKYGLAWREYCRRVPYRIVPYI
Y
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggctcagcagcagactgccccgagcccggccgaacttgagtttggggggcccctgggg
accgctgccctgctgctactgctccctctcaccctcttccacctgctcctcacctgccac
tcgggcccctgcagcctgctgagtctgcccccggagctgcccccgctctctgccttctgg
agctcgggggcgctgctgctgctgctgttctggctgggcttccaggccacgctctacctg
ctgcccatgggccaggtgactgagggcaggatgctgagagacaagagccacctgcagtac
ccacttaatgggttccggtgcctggggctgacagccctgctggtgggcctggggctggcg
gggggcctgccccttgggaacctctccgagatgctcctgccactggcttcagcagccacg
gtgacagccttcttcctcagcctcttcctctacctcaagtcctttacggtgcctccctcg
gccctggcccctgggggaaattcagggaaccctgtttatgacttcttccttggccgagaa
ctcaaccctcgttttggatcctttgacctcaaatatttctgtgagctgcggccaggactg
atgggctgggccttgattaacctggctctgctgctgcgggaggccgagcgccagaggggg
tggccttccctggccatggggctggtcagtgctttccagtttatctacgtggctgatgct
ctctggtacgaggaggcagttcttaccaccatagacatcatccatgatggctttggcttc
atgctggcttttggggacttggtctgggtccccttcatctacagtctgcaagcccagttc
cttctgaaccatccccaggccctggacctgcctgtggctggggccatctgtctgctaaaa
gtgatcggctacgttatctttcgtggggccaactcccagaagaacaccttccggaggaac
ccttctgaccccagtgtggctgggcttgagaccatccccacggcgacagggcggcacttg
ctggtgtcagggtggtggggcctggtccgccatccaaactatcttggagacctcatcatg
gctctggcctggtccctgccctgtggggtgacacacctccttccctacttctactttttc
tactttgtcatcctactggtgcaccgagagtaccgcgatgagcgccagtgcctccagaag
tatggcctggcttggcgggaatactgcaggagagtgccttaccgcatagtgccctacatc
tactga

DBGET integrated database retrieval system