KEGG   Monodelphis domestica (opossum): 100030872
Entry
100030872         CDS       T01031                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00230  Purine metabolism
mdo01100  Metabolic pathways
mdo01522  Endocrine resistance
mdo04015  Rap1 signaling pathway
mdo04020  Calcium signaling pathway
mdo04022  cGMP-PKG signaling pathway
mdo04024  cAMP signaling pathway
mdo04062  Chemokine signaling pathway
mdo04072  Phospholipase D signaling pathway
mdo04114  Oocyte meiosis
mdo04211  Longevity regulating pathway
mdo04213  Longevity regulating pathway - multiple species
mdo04261  Adrenergic signaling in cardiomyocytes
mdo04270  Vascular smooth muscle contraction
mdo04371  Apelin signaling pathway
mdo04540  Gap junction
mdo04611  Platelet activation
mdo04713  Circadian entrainment
mdo04714  Thermogenesis
mdo04723  Retrograde endocannabinoid signaling
mdo04724  Glutamatergic synapse
mdo04725  Cholinergic synapse
mdo04727  GABAergic synapse
mdo04742  Taste transduction
mdo04750  Inflammatory mediator regulation of TRP channels
mdo04911  Insulin secretion
mdo04912  GnRH signaling pathway
mdo04913  Ovarian steroidogenesis
mdo04914  Progesterone-mediated oocyte maturation
mdo04915  Estrogen signaling pathway
mdo04916  Melanogenesis
mdo04918  Thyroid hormone synthesis
mdo04921  Oxytocin signaling pathway
mdo04923  Regulation of lipolysis in adipocytes
mdo04925  Aldosterone synthesis and secretion
mdo04926  Relaxin signaling pathway
mdo04927  Cortisol synthesis and secretion
mdo04928  Parathyroid hormone synthesis, secretion and action
mdo04934  Cushing syndrome
mdo04935  Growth hormone synthesis, secretion and action
mdo04970  Salivary secretion
mdo04971  Gastric acid secretion
mdo04972  Pancreatic secretion
mdo04976  Bile secretion
mdo05032  Morphine addiction
mdo05163  Human cytomegalovirus infection
mdo05166  Human T-cell leukemia virus 1 infection
mdo05200  Pathways in cancer
mdo05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100030872 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100030872 (ADCY4)
   04371 Apelin signaling pathway
    100030872 (ADCY4)
   04020 Calcium signaling pathway
    100030872 (ADCY4)
   04072 Phospholipase D signaling pathway
    100030872 (ADCY4)
   04024 cAMP signaling pathway
    100030872 (ADCY4)
   04022 cGMP-PKG signaling pathway
    100030872 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100030872 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100030872 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100030872 (ADCY4)
   04062 Chemokine signaling pathway
    100030872 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    100030872 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    100030872 (ADCY4)
   04912 GnRH signaling pathway
    100030872 (ADCY4)
   04913 Ovarian steroidogenesis
    100030872 (ADCY4)
   04915 Estrogen signaling pathway
    100030872 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    100030872 (ADCY4)
   04921 Oxytocin signaling pathway
    100030872 (ADCY4)
   04926 Relaxin signaling pathway
    100030872 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    100030872 (ADCY4)
   04918 Thyroid hormone synthesis
    100030872 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    100030872 (ADCY4)
   04916 Melanogenesis
    100030872 (ADCY4)
   04925 Aldosterone synthesis and secretion
    100030872 (ADCY4)
   04927 Cortisol synthesis and secretion
    100030872 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100030872 (ADCY4)
   04270 Vascular smooth muscle contraction
    100030872 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    100030872 (ADCY4)
   04971 Gastric acid secretion
    100030872 (ADCY4)
   04972 Pancreatic secretion
    100030872 (ADCY4)
   04976 Bile secretion
    100030872 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100030872 (ADCY4)
   04727 GABAergic synapse
    100030872 (ADCY4)
   04725 Cholinergic synapse
    100030872 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    100030872 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    100030872 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    100030872 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    100030872 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    100030872 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100030872 (ADCY4)
   04714 Thermogenesis
    100030872 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100030872 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    100030872 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100030872 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100030872 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100030872 (ADCY4)
   05163 Human cytomegalovirus infection
    100030872 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100030872 (ADCY4)
Enzymes [BR:mdo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100030872 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 100030872
NCBI-ProteinID: XP_001380271
Ensembl: ENSMODG00000003033
Position
1
AA seq 1078 aa
MPRLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLAIVLSTLLALLAVTWASGRALDSDPA
FLAGVLGAFGGFALLLCLASREQRLQRWTRPVSALVWAALLALGHSFLFTGGVVSAWDQV
SFFLFIIFTVYTMLPLGMRDAAAAGLVSSLSHLLVLGLYLGSQSVSRPPLLPQLAANAVL
FLCGNAAGAYHKALMERALRDTFREALSSLHSRRRLDSEKRHQEHLLLSILQAYLAREMK
AEIMARLQLWEGPPALCSPGLCGSNFYSPPLYLSVLYADIVGFTRLASECSPKELVLMLN
ELFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHALNCVRMGLDMCRAIRKLRAAT
GVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLG
GAYAVEDAAPGHRDPYLRELGEPTYLVIDPRAEEKEEEEVTAGGPLSPPEGPKMRPSLLM
TRYLESWGAAKPFAHLGHLDSPVPTSPPLLENALASLGPQRSLDRTRTPRGLEDELDTGD
EKFFQVIEQLNSQKQWKRSKDFSPLTLYFRKKEMEKEYRLSALPAFKYYAACTFLVFLSN
FTIQMLVANRPPALAVTYGIIFTLFCLLLFICFSEHLTKCVLKGPKFLHWLPGLSGTIAT
RPGLRVALGTTTILIVLTMAIVNLFFQPMSECSFSASNSSTAALNISWDIPGSFPLISVP
YSMHCCVLGFLSCSLFLHMNFELKLLLLLLWLLASCSLFLHSHAWLSDCLVAHLYPTPSA
QRPGVLKEPKVMGAISFFVFFFTLLALARQNEYYCRLDFLWKKKLRQEREETETMENLTR
LLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINREGLECL
RLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDTQQDSERSCSHLGTM
VEFAVALGAKLDIINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMES
TGVLGKIQVTEETARVLQSLGYTCYSRGVIKVKGKGQLRTYFLSTELARTGPPGATLS
NT seq 3237 nt   +upstreamnt  +downstreamnt
atgccccgcctcttcagccccaggcctccccccagcgaagatctcttctacgagacttat
tacagcctgagccagcagtaccccctgttattactgctgctggccatcgtactttccacg
cttctcgctctgcttgcagtcacttgggccagcggtcgggcgctggactcagacccagcc
ttcctggccggggtgttgggcgcattcggaggctttgcacttttgctctgcctggcttcg
cgcgagcagcgtctgcagcgctggacccgcccggtatcggctctcgtatgggccgcccta
ctggccctgggccacagcttcctgttcaccggaggtgtggtcagcgcctgggaccaggtg
tctttcttcctctttatcatcttcactgtgtacaccatgctgcctttgggtatgcgggat
gcagctgcagccggtctggtctcttctttatcccacctcctagtccttgggctgtacctt
ggatctcaatctgtctcccggcccccgcttctccctcagttggctgccaacgcggtgctg
ttcttgtgcgggaatgcggcaggagcctatcacaaggcgctaatggagcgcgcgcttcgg
gacacgttccgggaggctctgagctccctgcactctaggaggcggctggattctgagaag
agacaccaggaacatctcctgctatccatcctgcaagcttacctagccagggaaatgaag
gctgagatcatggctcggctccagctctgggagggacctcctgcactttgttctccagga
ttgtgtggttctaatttctattccccacccctctacctcagtgtgctgtacgcagacatt
gttggcttcactcgactggccagcgaatgctccccgaaggaactggtgcttatgctgaac
gaactctttggcaagtttgatcagatcgccaaggaacacgagtgcatgcggattaagatt
ctgggagactgttactattgcgtttctggtctgccactttctctgccggaccacgcactc
aactgcgtgcgcatggggctggacatgtgccgtgctatccggaagctgagggctgccacg
ggagtggacatcaacatgcgtgtgggtgtgcactcgggcagcgtgctctgcggtgtcatc
ggtcttcagaagtggcaatacgacgtctggtcccatgatgtcaccctggctaaccacatg
gaggccggtggagtgccaggtcgagtgcacatcactggggcaaccctggccctgctggga
ggggcttatgctgtggaggatgcagctccagggcatcgggacccatatctccgagagctt
ggggaacccacctacctggtcattgacccaagggcagaggagaaagaagaagaggaagta
actgcagggggaccactgtcccctcctgagggacccaagatgcgtccatcacttctgatg
acccgatacttggagtcctggggtgcagccaagccttttgcccacctcggccacctggac
agtcctgtgcccacctcaccccctcttctggaaaatgccttggcctccctgggcccacag
aggagtctggaccggacccgaacccctcggggacttgaggatgaactggacactggggat
gaaaagttctttcaagtcatcgaacagctcaattcccagaaacaatggaaacgatctaag
gacttcagcccactgaccttatacttcagaaagaaagagatggagaaggagtatcgactc
tcagctcttcctgccttcaagtattatgcagcctgtacctttctggttttcctttccaac
ttcaccattcagatgcttgtggccaacaggcccccagctctggctgtcacttatggcatc
atcttcaccctcttctgcctcctcctcttcatctgcttctcagagcacttgacgaaatgt
gtcctgaagggtcccaagtttctgcactggctgccaggcctttcaggaactatagccaca
agacctggtcttcgagttgctctgggcaccaccaccatccttattgtcctcaccatggcc
atcgtcaacctgttctttcagccaatgtcagaatgctccttctcagcctccaattcctct
actgctgctctcaacatctcctgggatatccctggttcctttcctctaatcagtgtcccg
tactccatgcactgttgtgtgctgggcttcctctcctgttccctctttctgcatatgaac
ttcgaattgaagctgctgttgctactactctggttgttggcctcctgcagcctcttcttg
cattcccatgcctggctctctgactgccttgttgcccatctctacccaactcccagtgct
caaaggcctggggttctgaaggagcccaaagtgatgggtgccatctccttcttcgtcttc
ttctttacccttctggcgctggctcggcagaatgaatattattgccgattggatttccta
tggaaaaagaagcttcggcaagagcgggaggaaacagagaccatggagaacctgactcgg
ctgctgctggaaaatgtactacctgcacatgttgccccccagttcattggtcagaaccgg
agaaatgaggacctctaccaccaatcctatgaatgtgtttgtgtcctctttgcttctgtc
cctgacttcaaagagttttactctgagtccaacatcaaccgtgaggggctagagtgtctt
cggctgctcaatgagatcattgctgactttgatgagctactctctaaacccaagttcagt
ggtgtggaaaagatcaaaaccattggcagcacatacatggcagctacagggttaaatgcc
acctctggacaggacacgcagcaggactctgaaagaagttgcagccacctgggcacaatg
gtggagtttgcagtggccctgggggccaaactggacatcatcaacaagcactcattcaac
aacttccgcctgcgtgtggggttgaatcatggaccagttgtagctggggtaattggagca
cagaaaccacaatatgacatctggggcaacactgtgaatgtggcaagcagaatggaaagc
acaggcgttttgggcaagattcaggtaactgaggaaacagcccgggtcctacagtctttg
ggctacacctgctatagtagaggagtaatcaaagtaaagggcaaaggacagctccgaacc
tacttcctatccacagaattggcacggactgggccccctggggccacacttagctga

DBGET integrated database retrieval system