KEGG   Monodelphis domestica (opossum): 100031015Help
Entry
100031015         CDS       T01031                                 

Gene name
ARG1
Definition
(RefSeq) arginase 1
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00220  Arginine biosynthesis
mdo00330  Arginine and proline metabolism
mdo01100  Metabolic pathways
mdo01230  Biosynthesis of amino acids
mdo05146  Amoebiasis
Module
mdo_M00029  Urea cycle
mdo_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    100031015 (ARG1)
   00330 Arginine and proline metabolism
    100031015 (ARG1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    100031015 (ARG1)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100031015 (ARG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 100031015
NCBI-ProteinID: XP_007484626
Ensembl: ENSMODG00000017584
UniProt: F7B5B3
Position
2
AA seq 317 aa AA seqDB search
MSSKPKSIGIIGAPFSKGQPRGGVEEGPAALRTAGIVERLEERECDVKDYGNLTFVDVPN
DTPFQIVKNPRTVGKANEQLAGAVAEVKKNGRTSLVLGGDHSLAIGSISGHAKVHPDLCV
IWVDAHSDINTPLTTTSGNLHGQPVSFLMKELKGKIPDVPGLSWVTPCLSAKDIVYIGLR
DVDPGEHQILKDLGIKYFSMTEVDKLGIGKVMEETLSYLIGRKKRPIHLSYDVDGLDPSV
TPATGTPVPGGLTLREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVNRTVNTAIAIT
LSCFGVAREGNHSAKRL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagttccaagccaaagtcaattgggatcatcggagctcccttctccaaagggcagcca
cgaggaggagtagaagaaggtcctgcagcactgagaacagctggtatagttgaaagactt
gaagaacgagagtgtgatgtgaaagattatgggaacttgacctttgttgatgtgcccaat
gataccccctttcaaattgtgaagaatccaaggaccgtgggcaaggctaatgagcagcta
gctggagcagtagcagaagtgaagaagaatgggagaaccagcttggtacttggcggggat
cacagtttggcgattggaagtatctctggccatgccaaggttcaccctgatctctgcgtc
atttgggtagatgcacatagtgatatcaacactcctctgacaactacatctggcaactta
catggacagcctgtttctttccttatgaaggaactaaagggaaagatccctgatgttcca
ggattatcatgggtgacaccttgcttatcagccaaggacattgtatatattggattgaga
gatgtggatcctggtgaacatcaaattcttaaggatctgggcattaaatatttttcaatg
actgaagtggataagcttggaattggcaaagtgatggaggaaacactaagttacttaata
ggaaggaagaaaagaccaattcatctgagttatgatgtggatgggttggacccatctgtg
acaccagctactggcacacctgtccctggaggcctgactctcagagaaggtctctatatt
acagaagaaatctataagacagggctcctctcaggattagacataatggaagtcaatcca
tcccttggaaagacaccagaagaagtcaaccggacagtgaatactgctattgcgataact
ttatcctgttttggagtagctcgagagggcaatcatagtgccaagagactgtaa

DBGET integrated database retrieval system