KEGG   Monodelphis domestica (opossum): 100033224Help
Entry
100033224         CDS       T01031                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
mdo  Monodelphis domestica (opossum)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mdo01002]
    100033224 (ABHD12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdo04147]
    100033224 (ABHD12)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100033224 (ABHD12)
Peptidases [BR:mdo01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100033224 (ABHD12)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100033224 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Say1_Mug180 Peptidase_S15 Peptidase_S9 Thioesterase SR-25
Motif
Other DBs
NCBI-GeneID: 100033224
NCBI-ProteinID: XP_007476660
Ensembl: ENSMODG00000006439
Position
1
AA seq 422 aa AA seqDB search
MRKRNESVALEHERFAASASSSSSSSSPSSPATAAALDKDCRLKKNLRLAGKGTKELGSS
SNAGMKRAFGRKTTIIAEAYSNLRRKGLWFRLRKVFLWSLALYAAIPFLVKLCPGIQAKL
IFLNFVRVPYFIDLKKPQEQGLNHTYNYYLQPEEGVTIGVWHTVPTVLWKNAQGKDQAWY
EDTLASNHPIILYLHGNAGTRGGDHRVALYKVLSSLGYHVVTFDYRGWGDSIGTPTEPGM
TYDALHVFDWIKARSGYNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIRE
EAKSHPFSVVYRYFPGFDWFFLDPITSSGIRFANDENVKYISCSLLILHAEDDPIVPFHL
GRKLYNIAAPSQSFRDFKVQFVPFHRDLGYRHKYIYKSPELPRILREFLGKSEHEHHREL
RH
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagcggaacgagtcggttgccttggagcatgagcgcttcgctgcctctgcctcc
tcctcatcttcctcctcctctccctcttcccctgctaccgctgcagcgctggacaaggat
tgtcgcctgaagaagaacctgcgtctggcgggcaaggggacaaaggagctgggctcctcc
tccaacgcgggcatgaagcgggcgttcggcaggaaaacaacaataatagctgaagcatat
agtaatttaagaagaaagggattgtggtttcgcttgcggaaggtatttctatggtcgctg
gccttgtatgctgctattccattccttgtaaaactctgtcctgggatacaggctaagctg
attttcttgaattttgtgagggttccctactttattgacttgaaaaagccacaggaacaa
ggcttaaatcacacctataattactacctccagccagaagaaggagtaactattggagtc
tggcacacagtacctacagtcttatggaagaatgctcaaggaaaggaccaagcatggtat
gaggatactttggcttccaaccatcctatcattctttatttgcatggaaatgcaggcact
agaggaggagatcatcgagtggcactatacaaggttctgagttcccttggttaccatgta
gtcacctttgattacagaggctggggtgattcaataggaacgccaacagaaccgggaatg
acctatgatgctctacatgttttcgactggataaaagcaagaagtggttacaatcctgtg
tatatttggggccattcactgggcactggagttgcaaccaatttagtaaggcgcttatgt
gaacgagaaactcctccagatgccctcatattggaatctccattcacaaacatacgtgaa
gaagcaaaaagccatccgttttctgtggtatatcgatactttcctggatttgactggttc
ttccttgatcccatcacaagcagtggaattcgattcgcaaatgatgaaaatgtgaaatac
atatcatgctccttacttattcttcatgctgaagatgaccccatcgtgccattccaccta
ggaagaaagctctataacattgcagcgccatcgcagagcttccgggacttcaaagtccag
tttgtgccgtttcacagggatcttggctaccggcacaagtacatatacaagagtccagaa
ctacctcgaatcctgagggaattcctgggaaaatcagaacatgaacatcatcgcgagctc
cgccactga

DBGET integrated database retrieval system