KEGG   Monodelphis domestica (opossum): 100619065Help
Entry
100619065         CDS       T01031                                 

Gene name
THNSL2
Definition
(RefSeq) threonine synthase like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
mdo  Monodelphis domestica (opossum)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100619065 (THNSL2)
Enzymes [BR:mdo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     100619065 (THNSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 100619065
NCBI-ProteinID: XP_007477770
Ensembl: ENSMODG00000009601
Position
1
AA seq 432 aa AA seqDB search
MRYISTRGGTPSVDFEGALFSGYASDGGLFMPEEIPQLDRETLKQWSTLSYPALVMELCS
LFIDPELIPKKDLKGLIGRAFSRFRHRDVVHLSRLKNGLNVLELWHGITYAFKDLSLSCS
GQFLQYFLEKRQKHVTIVVGTSGDTGSSAIESVRGAKNIDIIVLLPLGLCSKIQELQMTT
VIEDNVHVFGAGCIAQEMGLPVRLATVVNHNDIIHRAVRQGDFSLSGNTRASLASAMDIQ
VPYNMERIFWLLSGADSKLVRALMEQFDRTQKLRLPQALHTKISETIDSLSASDEDIIQT
MRRCWEENHYLLCPHSAVAAFYHYKRSASEQPSFLDRLSVCDDRSHTQARRRGVAFLQQA
EGLVTGDQERPLNQAAPLGWGPAEERPSPPVFWGGTAALTGCVCSSVLPGPRGRCRLVRC
TQDRKLEAVSGH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaggtacatcagtactcggggaggaacccccagcgtggactttgaaggagccttgttc
tcaggctacgcctccgatgggggactcttcatgcctgaagagatccctcagctggacagg
gagaccttgaaacaatggagcactctctcctaccccgccctggtgatggagctgtgctcc
ctcttcatcgacccagagctcattccaaagaaggacttgaagggtctgattggccgagcc
ttcagcagattccgacaccgagatgtggttcatctgtccaggctgaagaatgggttgaat
gtgctagagctgtggcacggcatcacctatgcctttaaggacctgtccctgtcctgttca
ggacagttcttacagtactttctggagaaaaggcagaaacatgtcactatcgttgtagga
acttctggagacaccgggagctcagccattgagagtgtccgtggagccaaaaacatagac
atcattgttttgttacccctgggactctgctctaagatccaggagctccagatgacaaca
gtgattgaagacaatgtgcatgtgtttggggcgggatgcatcgctcaggagatgggtctg
cctgtccgcctggccaccgtggtgaaccataatgacattatccacagggctgtccggcag
ggcgacttctcactttcagggaacaccagagcatccttggcttctgccatggacattcag
gtgccttataacatggagaggattttctggctgctctccggggctgacagcaagctggtc
agggcgctgatggagcaattcgacaggacccagaagctgcggttgccacaagcgctacac
accaagatttcagagacgatagattccctgtcagcttcggacgaggacatcattcaaacc
atgcggcgatgctgggaggagaaccactacctgctgtgtccacattcggcggtggccgcc
ttctaccattacaaacggtcggccagcgagcagcccagcttcctggatcgtctttcagtc
tgcgatgaccgcagtcacacgcaggccaggcgacgaggagtggcatttcttcaacaagca
gaggggctggtcacgggagaccaagaacgtccgcttaaccaggctgcccctttgggctgg
ggtccagctgaagagcgtccgtccccgcccgtcttctggggagggacggcagcgctcact
ggctgtgtttgctcctcggttttaccagggccccgaggaaggtgtagattagtccgctgt
acacaggacaggaagctggaagcggtttcgggccactga

DBGET integrated database retrieval system