KEGG   Monodelphis domestica (opossum): 103106486
Entry
103106486         CDS       T01031                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04080  Neuroactive ligand-receptor interaction
mdo04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103106486 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103106486 (APLN)
SSDB
Motif
Pfam: Apelin LYRIC
Other DBs
NCBI-GeneID: 103106486
NCBI-ProteinID: XP_007507220
Position
X
AA seq 76 aa
MNLRRCLQALLLLWLSLASVCGGPLVEPSDRKELEEGNIRTLVQPKGARVGGPWPGGRRK
FRRQRPRLSHKGPMPF
NT seq 231 nt   +upstreamnt  +downstreamnt
atgaatttgcggcgctgcctgcaggcgctgctcctgctctggctctccctggcttcggtt
tgcggagggcccctggtggagccatcagacaggaaggagctggaggaagggaacattcga
accctggtgcagcccaaaggagcaagagttggaggaccctggccaggtggtaggaggaag
ttccgaaggcagcgtccccgtctctcccacaaaggccccatgcctttctga

DBGET integrated database retrieval system