KEGG   Monodelphis domestica (opossum): 107648882Help
Entry
107648882         CDS       T01031                                 

Gene name
CFB
Definition
(RefSeq) complement factor B
  KO
K01335  complement factor B [EC:3.4.21.47]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04610  Complement and coagulation cascades
mdo05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    107648882 (CFB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107648882 (CFB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mdo01002]
    107648882 (CFB)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.47  alternative-complement-pathway C3/C5 convertase
     107648882 (CFB)
Peptidases and inhibitors [BR:mdo01002]
 Serine peptidases
  Family S1: chymotrypsin family
   107648882 (CFB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin VWA Sushi VWA_2 VWA_3 Trypsin_2 HRM DUF1986 DUF316
Motif
Other DBs
NCBI-GeneID: 107648882
NCBI-ProteinID: XP_007483634
Position
2
AA seq 765 aa AA seqDB search
MASLPITMKKKSWARLCVLPLFLGLLAAGVSSAPSEPNKTCPLEGIEIAGGSFQVLKDGQ
FLEYTCPPGYYPYPMKIRNCKPWGAWSALQTNTKKIVKKAECRAIQCPGPEDFENGDFWP
RKRFYNISEEISFHCYDGYNLRGSVNRTCQSTGRWDGHTTICDNGAGYCQDPGIPIGTRK
AGRQYRPEDSVTYHCGQGLTLQGSQKRTCMEDGSWSGTEPSCRDSFMYDTPEEVSAAFIS
SLTETIEGADADDEYSPGGQQNRKIVLDPAGSMNIYLVLDASDSIGKNNFTGAKKCLSSL
IDKVASYGVEPRYAVVTYATEAKAVVKLSDKESSNADWVKQELEKIKYSDHRLKAGTNTK
KALTMLYEMMILQESQNDINWNKTRHVIVLMTDGNYNMGGDPVAAIEQIREFLDIGRNRK
NPRENYLDVYVFGIGPLVDQEKINALASKKDGEKHVFKVKDMEDLENVFYMMIDESKALS
LCGIAWGRHKSGRHEAQPWHVSINVIRPSAGKESCKGAVVSEYYVLTAAHCFNVDDQAHN
VKVDAGGVQNREVDSVYFHPDYDINRKKAEGIAEFYDYDIALVKLKKKFIFTKDLRPICL
PCTEPTTRALRLPLSTTCQQHEKELLPEKNVKALFVFEDKNNLMQKEVYIKNGEMKASCE
RDALKAQGYEKVRDISDVVTPRFLCTGGSSPHADPNTCKGDSGGPLIIHKKSRFIQVGVI
SWGVVDVCKRPNKAIPSHARDFHVNLFQVLPWLREKLKDEDLAFL
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcttcccatcactatgaagaagaaatcgtgggccaggctctgtgttcttccc
ttgttcctaggacttctagctgctggcgtgagctcagcaccatctgagcccaacaaaaca
tgtcctctggagggaatagagatcgcaggtggctcttttcaagttctcaaggatggccag
tttctggaatacacgtgcccacctggctactacccttatcccatgaagatccgtaattgc
aagccttggggggcctggagtgccctgcagaccaacactaagaagatagttaaaaaagct
gagtgcagggcaatccaatgtccaggccccgaggactttgagaatggtgacttctggcca
agaaaacgcttctacaatataagtgaagagatctctttccattgctatgatgggtataac
ctacgtggctctgtcaatcgtacctgccagtccactggccgttgggatggacatacaact
atctgtgataatggtgcgggttactgccaggaccctggcatccccattggaacaaggaag
gcaggcagacaataccgacctgaggatagtgtcacctaccactgtggccaagggctcacc
ttacaaggctcccagaagcgcacctgcatggaagacggatcctggagtggcacagagccc
tcttgccgagactctttcatgtatgatactccggaggaggtgtctgctgccttcatctct
tctctgacagagaccattgaaggggctgatgcagatgatgagtatagcccaggggggcag
cagaatcggaagattgtcctggaccctgcaggatccatgaacatctacctagtgctagat
gcatcagatagcattggcaagaacaacttcacaggagccaaaaagtgtctcagcagcctt
attgacaaggtggcgagttatggtgtggagccacggtatgcagtagtgacctatgccaca
gaagccaaagctgtggtcaaactgtcagataaggaaagcagtaatgcagactgggtcaag
caggagctggagaagatcaaatactcagatcaccgattaaaggcagggacgaacacaaaa
aaggcactaacaatgttgtatgagatgatgatcctacaggagtcccaaaatgatattaat
tggaataaaacacgccacgtgatcgtgctcatgactgacggaaattacaacatgggaggg
gaccctgtggctgctattgagcagatccgagagtttctggatattggaaggaaccgtaaa
aacccaagggaaaattatttggatgtctatgtatttggaattggtccccttgttgaccag
gagaagatcaatgctttggcttcaaagaaggatggagaaaagcatgtgttcaaagttaag
gacatggaagacctagagaatgtcttctacatgatgattgatgaaagtaaagctctaagt
ctgtgtgggatagcatggggacgccacaaaagtggacgccatgaagcacaaccctggcat
gtctccatcaatgttattcgaccctctgcaggaaaagagtcctgtaaaggggctgtggta
tcagaatactatgtgctgacagctgcccattgcttcaatgtggatgaccaggcccataat
gtcaaggttgatgcaggaggtgtgcagaacagggaggtagacagtgtctatttccaccct
gattatgacatcaatagaaaaaaagctgaagggattgctgaattctatgactatgacatt
gccctcgtcaagctcaagaagaagttcatattcacaaaagacctccgacccatctgtctt
ccatgcacagagccaacaactcgggctttgaggctcccattatcaaccacgtgccaacaa
catgagaaagaattgctgcctgaaaagaatgtcaaagctctatttgtgtttgaggacaag
aacaacttgatgcagaaggaagtatacataaagaatggggaaatgaaagccagctgtgaa
cgagatgccctcaaagcccaaggctatgagaaagtaagggatatctctgatgtagtaaca
ccccgattcctctgcactgggggatcaagtcctcacgctgaccccaacacctgtaaaggg
gattctggtggtccacttattattcacaagaaaagccgtttcattcaagtgggtgtgatt
agctggggtgtggtagatgtctgcaaacgacccaacaaagccattccctcccacgcccgt
gacttccacgtcaacctcttccaagtattgccttggcttcgggagaaactgaaggatgag
gatctagccttcttgtga

DBGET integrated database retrieval system