KEGG   Monodelphis domestica (opossum): 554233Help
Entry
554233            CDS       T01031                                 

Gene name
BDNF
Definition
(RefSeq) brain derived neurotrophic factor
  KO
K04355  brain-derived neurotrophic factor
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04010  MAPK signaling pathway
mdo04014  Ras signaling pathway
mdo04024  cAMP signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04722  Neurotrophin signaling pathway
mdo05016  Huntington's disease
mdo05030  Cocaine addiction
mdo05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    554233 (BDNF)
   04010 MAPK signaling pathway
    554233 (BDNF)
   04024 cAMP signaling pathway
    554233 (BDNF)
   04151 PI3K-Akt signaling pathway
    554233 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    554233 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    554233 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    554233 (BDNF)
   05034 Alcoholism
    554233 (BDNF)
Cytokines and growth factors [BR:mdo04052]
 Growth factors
  Growth factors (RTK binding)
   554233 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NGF Spaetzle
Motif
Other DBs
NCBI-GeneID: 554233
NCBI-ProteinID: XP_007497258
Position
5
AA seq 272 aa AA seqDB search
MFHQNPGVESITTFIIMPEFHQVRRVMTILFLTMVISYFGCMKAAPMKETSVRGQGSLAY
PNMRTHGTLESLNGPKAGSRGLTSLADTFEHVIEELLDEDQNVQPREENKDADLYTSRVM
LSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKT
AVDMSGGTVTVLEKVPVPKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYV
RALTMDNKKRVGWRFIRIDTSCVCTLTIKRGR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatcagaatccaggggtggaaagcatcacaacattcataatcatgcctgagttc
caccaggtgagaagagtgatgaccatccttttccttactatggttatttcatacttcggt
tgcatgaaggctgccccgatgaaagaaaccagtgtccgaggacaaggcagcttggcctac
ccgaatatgcggacccacggaactctggagagtctaaatgggcccaaggcaggttcaagg
ggactgacatcattggctgacacttttgaacatgtgatagaagagcttctggatgaggac
cagaacgttcagccgagggaagagaataaggatgccgacttatacacatctagggtcatg
ctcagcagtcaagtgcctttggaaccccccctgctctttctccttgaggaatacaaaaat
tacctggatgcggcaaacatgtccatgagggtccgtcgccattctgaccctgcccgtcga
ggggagctgagcgtgtgtgacagtattagcgagtgggtcacagcggcggataaaaagact
gcagtggacatgtcgggggggacggtcacagtccttgaaaaggtcccagtccccaaaggc
caactgaagcaatatttctacgagaccaagtgtaatcccatgggttatacaaaagaaggt
tgcagaggcatagacaaaaggcattggaactcccagtgtcgaactacccagtcttacgtg
cgagcgctcaccatggataataaaaagagagtcggttggaggttcatcagaatagacact
tcctgtgtatgtacactgactattaaaaggggaagatag

DBGET integrated database retrieval system