KEGG   Mogibacterium diversum: C5Q96_01085Help
Entry
C5Q96_01085       CDS       T05355                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mdv  Mogibacterium diversum
Pathway
mdv00450  Selenocompound metabolism
mdv00970  Aminoacyl-tRNA biosynthesis
mdv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    C5Q96_01085
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C5Q96_01085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mdv01007]
    C5Q96_01085
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mdv03016]
    C5Q96_01085
Enzymes [BR:mdv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     C5Q96_01085
Amino acid related enzymes [BR:mdv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   C5Q96_01085
Transfer RNA biogenesis [BR:mdv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    C5Q96_01085
 Prokaryotic type
   Other AARSs
    C5Q96_01085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f NAD_binding_5
Motif
Other DBs
NCBI-ProteinID: AVM47534
UniProt: A0A2S0L2T2
Position
229560..231161
Genome map
AA seq 533 aa AA seqDB search
MTEKKGTFYITTPIYYPSAKLHIGHTYCTVMADAMARFKRLTGYDVRFLTGTDEHGQKIA
KCAQEAGVTPIEYIDPIVDTIKRLWATMEISYDDFIRTTEERHEKRVQEIFMKMYNNGDI
YKDKYEGWYCTPCESFWTESQLVEGNCPDCGRPVKKMSEDAYFFKLSKYSDKLVELLGNG
TFLQPESRAKEMISFVEQGLEDLCISRASLDWGIKVPIDERHVIYVWLDALSNYITALGF
PGEDEEQYKKYWPGINLVGKEIVRFHSIIWPAMLMSMNEPVPKKVLGHGWILIDGGKMSK
SKGNIVDPEILIDRYGIDALKYFLLREYTFGQDGLYTNEIMLNRINYDLANDLGNLLSRT
VSMIEKYCGGVVPEATTEDDFDRDLIATALGCAAKVEAHMDEFRFNNALEEIWIVISRAN
KYIDEKMPWVLAKDESKKAELDTVMSNLAEVLRMISVLIIPYMHTTSDRMRDQLGISNQE
AKWSDLEEFRMMAGANVHKGDALFPRLDVAKEIEVLSNTEQEKVAIKKNNRKK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaaaaagggcactttttatattactacacctatatactatccaagcgctaag
ctgcacattggacacacatactgcaccgttatggcagacgctatggcgagatttaagagg
cttactggatatgatgtaagattcctcacaggtactgacgagcacggtcagaagatcgct
aagtgtgcacaggaagctggcgtgacaccgattgaatatatcgatccaattgttgataca
attaagagactctgggcgacgatggagattagctatgatgactttatcagaaccacagag
gagcgccatgaaaagcgtgttcaggaaatcttcatgaagatgtacaacaatggtgatatc
tacaaggataagtacgaggggtggtactgcactccttgtgagtccttttggacagagagc
caactagtagaaggaaactgccctgattgcggtagacctgttaagaagatgagcgaagat
gcatacttctttaagctgtcaaagtattctgacaagcttgttgagcttcttggaaatggc
acattccttcagcctgaatctcgtgcgaaggagatgatttcatttgtagagcaggggctc
gaggacctatgtatctcgagagcttcattagattggggcatcaaggttccgattgatgag
agacacgtaatctatgtgtggctcgatgctctatcaaactatattaccgcccttggattc
cctggtgaggatgaagagcagtacaaaaagtactggccaggaataaacctagtaggtaag
gaaatcgtaagattccactccattatctggcctgcaatgctcatgtccatgaatgagcca
gtgcctaagaaggttcttggtcacggatggattctaatcgatggtggtaagatgtcgaaa
tcgaagggcaatattgttgatccggagattctaatcgatcgttatggaatagatgcgctt
aagtatttcttgctcagagagtatacttttggtcaagacgggctatataccaacgaaatc
atgcttaaccgcatcaactacgacctcgctaatgaccttggaaacctcctatcgagaacc
gtttcgatgattgaaaagtattgcggcggagtggttccagaagctacgactgaggatgat
ttcgatcgtgacctgattgctacagcactcggatgcgctgcgaaggttgaagcccacatg
gatgaattccgcttcaacaatgcgctcgaggagatttggatagttatttcgagagctaac
aagtatatcgacgaaaagatgccttgggttcttgcaaaggacgagagtaagaaagccgaa
cttgatacagttatgagcaatctagcagaggtgctcagaatgatttctgtgttaatcatc
ccatatatgcatacgacttcagataggatgagagatcagctcggaatttcaaatcaagag
gcaaaatggtcggatctcgaagagttccgcatgatggctggggcaaatgtccacaaagga
gatgctttgttcccaaggctagatgtagctaaggagatcgaagttctatctaatacagaa
caggaaaaggttgctataaagaagaacaaccgaaaaaaataa

DBGET integrated database retrieval system