KEGG   Mogibacterium diversum: C5Q96_03860Help
Entry
C5Q96_03860       CDS       T05355                                 

Definition
(GenBank) D-alanine--poly(phosphoribitol) ligase
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
mdv  Mogibacterium diversum
Pathway
mdv00473  D-Alanine metabolism
mdv01100  Metabolic pathways
mdv01503  Cationic antimicrobial peptide (CAMP) resistance
mdv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mdv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C5Q96_03860
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C5Q96_03860
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    C5Q96_03860
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:mdv01504]
    C5Q96_03860
Enzymes [BR:mdv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     C5Q96_03860
Antimicrobial resistance genes [BR:mdv01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    C5Q96_03860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AVM48020
UniProt: A0A2S0L412
Position
complement(817122..818639)
Genome map
AA seq 505 aa AA seqDB search
MDIIAKIKSTAIETPDRLVFSSRDGKMTYGELWKKSSALASYISNRLEGNREPIMVYGHK
HPDMLVAFLACVRSGHAYCPVDIGNPRERVSDIASAIDNEIVIVVQHEEMIDIDDKYEIV
GREKLDTILESDTSYDDNEPVSGDETYYIIFTSGSTGKPKGVKIPADALNNYLKWSVTLS
GGIPEATRFLNQAPFSFDLSVMDLYTGLATGSTIIALDKGLQQDMPEMLKYIASSDIEYW
VSTPSFSDMCLGEADFSEENFGSIKAFLFCGEVLTKDTAKQLRSRFPHAKVINTYGPTES
TVCVTEVDITDEVIAREGALPIGLPKPGTEIRIDPENSEMIIVGDSVSSGYYKDKERTDK
VFFMAEAGSLSENPKDMVRAYRTGDTGHYDESGMLFCDGRIDHQVKLHGYRIELGDIESN
LTNIEGVAAAAVIPKRHEGKVESLTAFVVREGDIIADDYSGRKYVRETLKSFLPSYMVPK
RVKFIDKMPLTNNGKADRKKLEELV
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggatatcatagcaaagattaagagcactgctatagaaacacctgatcgcttggtgttt
agctcgagagatggcaagatgacatatggcgaactttggaaaaagtcatcagcacttgct
agctacatatcgaatagactagagggaaatcgcgaacctattatggtctatggacacaag
catcctgatatgctcgttgcttttctcgcatgtgtgagatcgggtcatgcgtattgtcca
gtagatataggcaaccctagggagagggtgagcgatattgcatcagctatagataatgag
attgtaatagttgtacagcacgaagagatgattgatatagatgataagtacgagattgtg
ggtagagaaaaactcgatactattcttgaaagtgacacctcttatgatgataacgagcct
gtgtcaggtgatgagacgtattacataatatttacatctggaagcacaggaaagcctaag
ggcgttaaaatcccagctgatgcgcttaacaactacttaaaatggtcagttacactttca
ggcggaattccagaggctactagatttttaaatcaagctcccttttcttttgacctatct
gtaatggatttgtacactggactcgcaactggatcgacaattattgcgctagataaggga
ttacagcaggatatgccggagatgctaaagtatattgcatcgtccgatatcgaatactgg
gtatctactccttccttttctgatatgtgccttggagaagctgattttagcgaggaaaat
tttggaagcatcaaggcgttcctgttctgcggagaggttcttactaaagatacggcaaag
cagctaagatctagatttccacatgctaaggtaatcaatacatatggaccgacagaatcg
accgtatgcgtgacagaggttgatatcacagatgaggttatcgctagagaaggcgcactt
cctatcgggcttcctaagccaggaaccgagattagaattgatccagagaacagcgaaatg
ataatcgtcggagattcagtaagctcaggatactataaggacaaggagagaactgataag
gtcttcttcatggctgaggccggatctcttagtgaaaatcctaaggatatggttagggct
tatagaacaggcgatacagggcactacgatgagtcaggcatgctattctgcgatggcaga
atcgaccatcaggttaagctgcatgggtatagaatagagcttggagatattgagtctaac
cttacgaatattgaaggagttgcagctgcggcggttattccaaagagacatgagggaaag
gttgaaagcttaacagcatttgttgtaagagaaggagatatcatcgctgatgactatagt
ggcagaaaatatgtgcgcgaaacgttaaaatcatttttgcctagctacatggtcccaaag
cgtgtaaagtttatagacaagatgccacttactaataacggtaaggcagatagaaagaaa
ttggaggagttggtatag

DBGET integrated database retrieval system