KEGG   Mogibacterium diversum: C5Q96_07265Help
Entry
C5Q96_07265       CDS       T05355                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mdv  Mogibacterium diversum
Pathway
mdv00480  Glutathione metabolism
mdv00590  Arachidonic acid metabolism
mdv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    C5Q96_07265
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C5Q96_07265
Enzymes [BR:mdv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     C5Q96_07265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AVM48660
UniProt: A0A2S0L5T6
Position
complement(1510405..1510950)
Genome map
AA seq 181 aa AA seqDB search
MAQIYDFKLARPDGSELNLADNKGKVMLIVNTATGCGFTPQYEPLEALYKELHESGLEII
DIPCNQFGGQAPGSDDEIHEFCTLNYNTTFPQLKKSDVNGENELPLYTFLKSQKGFEGFG
DFPDREKFEEFVAMGNPDFRNNANIKWNFTKFVVDREGNVVARFEPTADMGEVAAFVKSL
I
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcacagatttatgattttaagctagctagacctgatggaagtgagctaaacctagct
gataacaagggcaaggtaatgctcatcgttaacactgcaactggatgtggattcacacct
cagtacgagccactagaggcactttacaaggagctacacgagtccggactagagattatc
gatatcccttgcaaccagttcggtggacaggcacctggatcagatgatgagatccatgag
ttctgcacactcaattacaacactacattcccacagcttaagaagtcagatgtaaacggc
gagaatgagcttccgctttacacattcctcaagagccagaagggctttgagggcttcgga
gacttcccagacagagagaagtttgaagagtttgttgcaatgggcaatcctgatttcaga
aacaatgctaacatcaagtggaacttcactaagttcgttgtagatagagaaggaaacgta
gttgctagattcgagccaacagctgatatgggtgaggttgctgccttcgtaaagagcctt
atctaa

DBGET integrated database retrieval system