KEGG   Mycobacterium dioxanotrophicus: BTO20_00155Help
Entry
BTO20_00155       CDS       T05102                                 

Definition
(GenBank) leucine--tRNA ligase
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BTO20_00155
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mdx01007]
    BTO20_00155
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mdx03016]
    BTO20_00155
   03029 Mitochondrial biogenesis [BR:mdx03029]
    BTO20_00155
Enzymes [BR:mdx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     BTO20_00155
Amino acid related enzymes [BR:mdx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BTO20_00155
Transfer RNA biogenesis [BR:mdx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BTO20_00155
 Prokaryotic type
    BTO20_00155
Mitochondrial biogenesis [BR:mdx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BTO20_00155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1_2 tRNA-synt_1 tRNA-synt_1g Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ART67248
UniProt: A0A1Y0BWI2
Position
31787..34687
Genome map
AA seq 966 aa AA seqDB search
MSVPQRSPYTLLVVTEPATTQPGADTSRAGDTPGHRYTAELAGEIEQAWQERWHVLGTFN
VANPVGTLAPTDGSAVPVDKMFVQDMFPYPSGEGLHVGHPLGYIATDVYARYYRMTGRNV
LHALGFDAFGLPAEQYAVQTGTHPRTRTEANIVNFRRQLGRLGLGHDARRSFATTDVDFY
KWTQWIFLQIYNAWFDPEQNKARPIAELEAEFASGARVLDDGRQWSQLSRAEQATVIDSH
RLVYRADSMVNWCPGLGTVLANEEVTSDGRSDRGNFPVFRKRLRQWMMRITAYSDRLLED
LDVLDWPDKVKTMQRNWIGRSTGAQVHFGTDAGDVEVFTTRPDTLFGATYLVLAPEHPLV
ERLTAAAWPDGVDSRWTYGGATPAEAVSSYRAAIAAKSDLERQENKTKTGVFLGAYATNP
VNDHKIPVFIADYVLIGYGTGAIMAVPGGDQRDWDFATEFGLPIVEVVAGGDISVSAYTG
EGTMVNSAYLDGLDIETAKATIVEHLEAAGRGQRRIEYKLRDWLFARQRYWGEPFPIVYD
ADGQAHPLPESALPVELPDVPDYSPVLFDPDDASSEPSPPLNKATEWVHVELDLGDGLQS
YTRDTNVMPQWAGSSWYELRYADPHNSEEFCDKVNEAYWMGPRPELHGPADPGGVDLYVG
GVEHAVLHLLYSRFWHKVLYDLGYVTSREPYRRLVNQGYIQAFAYTDSRGSYVPAAEVVE
RDGKFYYEDNEVNQEFGKIGKSLKNSVSPDEICDEYGADTLRVYEMSMGPLEASRPWATK
DVVGSHRFLQRVWRAVIDETTGAERAAEHEALDDATLRILHRTIAGVTEDYAALRNNTAV
AKLIEYTNHLTKEGVSSRDALEPLVLMLAPLAPHLAEELWKRLGHDTSLAHGPFPVADPA
YLVDDTVEMPVQVNGKVRGKVTVAADADKGALEAAALADEKVQAFLDGKTPKKVIVVPGR
LVNLVV
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atttcggtcccgcagcggtcgccttataccctgttggtcgtgaccgaacccgcaaccacc
cagccaggcgcagatacttcgcgtgcgggcgacaccccggggcaccgctacaccgcggag
ctggccggggaaatcgagcaggcctggcaggaacggtggcacgtgctgggtacttttaat
gtcgccaacccggtcggcacgctggcgccgacggacggctcggccgtccccgtcgacaag
atgttcgtgcaggacatgttcccgtatccgtcgggtgagggtctgcacgtcggtcatccg
ctgggctacatcgccactgacgtgtacgccaggtactaccggatgacgggtcgtaacgtt
ctgcacgcgttgggcttcgacgcgttcggtctgccggccgagcagtatgcggtccagacc
ggcacgcatccccggacccgcaccgaggccaacatcgtcaacttccggcgtcagctgggc
cggctgggcctgggccatgacgcccgtcgcagcttcgccaccaccgacgtcgacttctac
aagtggacccagtggatcttcctgcagatctacaacgcctggttcgatccggagcagaac
aaggctcggcccatcgccgagctggaggccgagttcgcctcgggtgcccgggttctggac
gacggtcggcagtggtcgcagctgagccgtgccgagcaggccaccgtcatcgattcgcat
cggctggtgtatcgcgccgattcgatggtgaactggtgtccgggactgggcacagtgttg
gccaacgaggaggtcacctccgacggccgcagcgaccgcggcaacttcccggtgttccgt
aagcggttgcggcagtggatgatgcggatcaccgcctactccgaccggttgctcgaggat
ctcgatgtgctggattggccggacaaggtcaagaccatgcagcgcaactggatcggccgc
tccacgggcgcgcaggtgcatttcgggaccgacgccggtgacgtcgaggtgttcaccacc
cgcccggatacgctgttcggcgccacctatctggtgttggcgcccgaacatccgctggtc
gagaggctgaccgccgcggcatggccggacggcgtcgacagccggtggacctacggtggc
gccacgcccgccgaggcggtgtcgtcctaccgggccgcgatcgccgcgaagtcggatctg
gaacgccaggagaacaagaccaagaccggcgtgttcctcggtgcctacgccaccaatccg
gtcaacgatcacaagatcccggtcttcatcgccgactacgtgctgatcggctacggcacc
ggggccatcatggcggtgcccggcggtgaccagcgggactgggacttcgccaccgagttc
ggcctgcccatcgtggaagttgttgccggaggcgatatctcggtgtcggcctataccggc
gagggcaccatggtgaactccgcctacctcgacgggctggacatcgagacggccaaggcc
accatcgtcgagcacctcgaggccgcgggccgcgggcagcgccgcatcgaatacaagctg
cgggactggctgttcgcgcggcagcggtactggggcgagccgttcccgatcgtctacgac
gccgacggccaggcccatccgctgccggaatccgctctgccggtggaacttccggatgtg
cccgactattcaccggtgttgttcgaccccgacgacgcgagcagcgaaccgtccccgccg
ttgaacaaggcgaccgagtgggtgcatgtcgagctggatctcggcgacggcctgcagagc
tacacccgcgacaccaacgtgatgccgcagtgggccggcagctcctggtacgagctgcgc
tacgccgacccgcacaactcggaagagttctgcgacaaggtgaacgaggcctactggatg
ggcccgcgccccgaactgcacggcccggccgatcccggtggggtggatctgtacgtcggc
ggtgtcgaacatgcggtgctgcacctgctgtactcgcggttctggcacaaggtgctctac
gacctgggctacgtgacctcacgcgagccgtaccggcgtctggtcaaccagggctacatc
caggcgttcgcctacaccgactcccggggcagctacgtgcccgccgccgaggtcgtcgag
cgggacggcaagttctactacgaggacaacgaggtcaaccaggagttcggcaagatcggc
aagagcctcaagaactcggtctcgcccgacgagatctgcgacgagtacggcgcggacacg
ctgcgcgtgtacgagatgtcgatgggtccgctggaggcgtcgcggccgtgggccaccaag
gatgtcgtcggctctcaccggttcctgcagcgggtctggcgcgcggtgatcgacgagacc
accggcgccgaacgcgccgccgagcacgaggcgctcgacgacgcgacgttgcggatcctg
catcggaccatcgccggggtgacggaagactatgcggccctgcgcaacaacaccgccgtc
gccaagctgatcgagtacaccaaccacctcaccaaggaaggcgtgtcgtcacgcgatgcg
ctcgaaccactagtgttgatgctggcgccgctggcaccgcacctggccgaggagctgtgg
aagcggctggggcacgacacctcgctggcgcacggaccgttcccggtggccgacccggcc
tacctggtcgacgacactgtcgagatgcccgtccaggtcaacggcaaggtgcgcggcaag
gtcacggtggccgcggatgcggacaagggcgcgctggaagcggcggctctggccgacgag
aaggtgcaggcgttcctcgacgggaagacgcccaagaaggtcatcgtcgtgcccgggcgg
ctggtcaacctcgtcgtctga

DBGET integrated database retrieval system