KEGG   Mycobacterium dioxanotrophicus: BTO20_09080Help
Entry
BTO20_09080       CDS       T05102                                 

Definition
(GenBank) glycogen synthase
  KO
K16148  alpha-maltose-1-phosphate synthase [EC:2.4.1.342]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00500  Starch and sucrose metabolism
mdx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BTO20_09080
Enzymes [BR:mdx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.342  alpha-maltose-1-phosphate synthase
     BTO20_09080
Glycosyltransferases [BR:mdx01003]
 Polysaccharide
  Storage polysaccharide
   BTO20_09080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_trans_1_2 Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: ART73513
UniProt: A0A1Y0CE18
Position
complement(1894939..1896114)
Genome map
AA seq 391 aa AA seqDB search
MTREYPPEVYGGAGVHVTELVAQLRHLCEVDVHCMGAPREGAIVAQPDPALAGANAALST
LSADLNMVNSAAQATVVHSHTWYTGMAGHLTALLYGIPHVLTAHSLEPMRPWKAEQLGGG
YRISSWVERTAVEAADAVIAVSAGMREDVLRTYPGLAPDRVHVVRNGIDTDVWFPAHARS
DSGDAHASGGESVLADLGVDPTRPIVAFVGRITRQKGVAHLVAAAHTFSPDVQLVLCAGA
PDTPEIAAEISGAVAELARARSGVFWVQEMLPAHKIREILSAATVFVCPSVYEPLGIVNL
EAMACSTAVVASDVGGIPEVVADGETGLLVHYDAAEPGAFESGLAEAVNSLVADPQRAAG
YGAAGRERCIREFSWAHIAEQTVEIYRKVAG
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgactcgggagtatccacccgaggtgtacggcggtgcgggagttcatgtcacggagctc
gtcgcccagctacgtcatttgtgtgaggtcgacgtgcactgtatgggtgcaccgcgcgaa
ggggccatcgtggcacagcccgaccccgcgttggcgggcgccaatgcggcgctgtcgacg
ctctcggccgatctgaacatggtcaacagcgccgcgcaggcgacggtcgtgcactcgcac
acctggtacacgggcatggcagggcatctcaccgcgctgctgtacggcattccccacgta
ctgacagcacactcactggaaccgatgcggccgtggaaggccgaacagctcggcggcggc
taccgcatctcctcgtgggtcgaacgcaccgccgtcgaggcggccgatgcggtcatcgcg
gtcagtgcggggatgcgcgaggacgtcctgcgtacctatccggggctggctccggatcga
gtgcacgtggtgcgcaacgggatcgacaccgacgtgtggttccctgcgcacgcgaggagc
gattcaggagatgcgcacgcgagcggcggcgaatcggtgctcgccgatctcggcgtcgac
ccgacccgccccatcgtcgcgttcgtcggacgcatcacccgccagaagggtgtggcgcac
ctggtcgccgcggcgcacaccttcagccccgacgtgcagctggtgttgtgcgcgggagcg
cccgacacccccgaaatcgctgcggagatctccggcgcggtggccgaactggcccgcgcc
cgatcaggcgtgttctgggtgcaggaaatgctgcccgctcataagatccgggaaatactg
tccgccgcaacggtttttgtgtgcccgtccgtgtatgagccactgggcatcgtgaatctg
gaagcgatggcatgctcgacggccgtggtggcgtcggatgtcgggggaatccccgaagtg
gtcgccgacggtgagaccgggctgctggtgcactatgacgcagccgaaccgggcgccttc
gagtcgggactggccgaagccgtcaactcactggtggccgacccgcagcgggccgccggg
tacggcgcggccggacgcgaacggtgcatccgggaattctcctgggcccacatcgccgag
cagacggtggagatctaccgcaaagtggcgggatag

DBGET integrated database retrieval system