KEGG   Mycobacterium dioxanotrophicus: BTO20_11925Help
Entry
BTO20_11925       CDS       T05102                                 

Definition
(GenBank) valine--tRNA ligase
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BTO20_11925
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mdx01007]
    BTO20_11925
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mdx03016]
    BTO20_11925
Enzymes [BR:mdx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     BTO20_11925
Amino acid related enzymes [BR:mdx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BTO20_11925
Transfer RNA biogenesis [BR:mdx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BTO20_11925
 Prokaryotic type
    BTO20_11925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g Val_tRNA-synt_C tRNA-synt_1_2 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ART69196
UniProt: A0A1Y0C284
Position
2472122..2474773
Genome map
AA seq 883 aa AA seqDB search
MTSTPDNRADALPKSWEPGAVEAELYQGWVDAGYFTADATSDKPAYSIVLPPPNVTGSLH
MGHALDHTLMDVLTRRKRMQGYEVLWLPGMDHAGIATQTLVEKQLAADGKTKEDFGREEF
VEKVWDWKRESGGTIGAQMRRIGDGVDWSRDRFTMDDGLSRAVRTIFKRLFDAGLIYQAE
RLVNWSPVLETAISDLEVKYEDVEGELVSFRYGSMSDDEPHIVVATTRVETMLGDTAIAV
HPDDERYRHLVGTTLPHPFTDARIIIVADTHVDPEFGTGAVKVTPAHDPNDFEIGLRHQL
PMPTIMDTKGRIADTGTQFDGMDRFEARVKVREALAEQGRIVAEKRPYLHSVGHSERSGE
PIEPRLSLQWWVKVESLAKAAGDAVRGGDTVIHPPSLEPRWFAWVDDMHDWCISRQLWWG
HRIPIWHGPNGETVCVGPDETPPEGWEQDPDVLDTWFSSALWPFSTMGWPDHTADLAKFY
PTSVLVTGYDILFFWVARMMMFGTFVGDDPAITLEGKRGRQVPFQNVFLHGLIRDEFGRK
MSKSRGNGIDPLEWVEMFGADALRFTLARGASPGGDLSIGEDHARASRNFATKLFNATRF
ALMNGAAPAALPPAAELTDADRWILGRLEEVRAEVDEALDSYQFSRACEALYHFAWDEFC
DWYVELAKVQIFGGLPHTTAVLAAVLDTLLKLLHPVMPFVTETLWKTLTGGESAVIAAWP
QPSGFAPDPVAAQRITDMQKLITEVRRFRSDQGLADRQKVPARLSDIAAAQLSEQLPAIT
SLAWLTEAGDGFTPSAAVEVRLSQTTVVVEVDTSGTVDVAAERRRLEKDLAVAQKEMATT
AAKLGNDAFLAKAPAEVVDKIRGRQQVATEEVERITARLAGLK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
gtgacctccacccctgacaatcgcgccgacgccctccccaagtcctgggagccgggtgcg
gtagaagccgagctgtaccagggctgggtggatgccggttacttcaccgccgacgccacg
agtgacaagcctgcctattcgatcgtgctgccgccgccgaatgtgaccggcagcctgcac
atgggccacgccctggaccacaccttgatggacgtgctgacccggcgtaagcggatgcag
ggctatgaagtgctgtggctgcccggcatggaccacgccggcatcgccactcagaccctg
gtcgagaagcaactcgccgccgacggcaagacgaaggaagacttcggccgggaagagttc
gtcgagaaggtgtgggactggaagcgcgagtccggcggcaccatcggcgcccagatgcgc
cgcatcggcgacggtgtggactggagccgcgaccggttcaccatggacgacggcctgtcc
cgtgcggtccgcacgatcttcaagcgcctgttcgacgccggactgatctaccaggccgag
cggctcgtcaactggtcgcccgtgctggagaccgcgatcagcgacctcgaggtcaagtac
gaggacgtcgagggtgaactcgtgtcgttccgctacggctcgatgagcgacgacgagccc
cacatcgtggtggccaccacccgcgtcgaaaccatgctgggcgacaccgcgattgccgtg
caccccgacgacgagcggtaccgccatctggtcggcacgacattgccgcacccgttcacc
gatgcccgcatcattatcgtggccgacacccacgtcgaccctgaattcggtacgggcgca
gtcaaagtcacccccgcacacgatccgaacgacttcgagatcgggttgcgccaccagctg
ccgatgccgaccatcatggacaccaagggccggatcgccgacactggaacgcaattcgac
gggatggaccggttcgaggcacgcgtcaaggtgcgcgaggcgttggccgagcagggccgg
atcgtcgccgagaagcggccctacctgcacagcgtgggacactcggagcgcagtggcgag
cccatcgaaccgcgactgtcgctgcagtggtgggtcaaggtggagagcctggccaaggcc
gccggtgacgcggtgcgcggtggcgacaccgtgattcacccgccgagcctggagccgcgg
tggttcgcctgggtcgacgacatgcacgactggtgtatctcgcggcagctgtggtggggt
caccggatcccgatctggcacggcccgaacggtgagacggtgtgcgtcggacccgacgag
actccgccggaaggctgggagcaggaccccgacgtgctcgacacctggttctcgtcggcg
ctgtggccgttctcgaccatgggctggcccgaccacacggccgatctggccaagttctat
cccaccagcgtgctggtcaccggatacgacatcctgttcttctgggtggcccgcatgatg
atgttcggcacgttcgtcggcgacgacccggcgatcacgctcgagggcaagcgtggccgc
caggtgccattccagaatgtgttcctgcacgggctgattcgcgacgagttcggccgcaag
atgagcaagtcgcggggcaacggcatcgacccgctcgagtgggtggagatgttcggcgcc
gacgcgttacggttcaccctcgcgcgcggtgcgagccccggcggtgatctgtccatcggc
gaggaccacgcccgtgcctcacgtaacttcgccaccaagttgttcaacgcgacccggttc
gcgctgatgaacggagccgcccccgcggccctaccgcccgcggccgagctgaccgacgcc
gaccgctggattttgggccggctggaagaggtccgcgccgaggtcgacgaagcgctcgac
tcctaccaattcagccgggcttgcgaggcgctgtaccacttcgcgtgggacgagttctgc
gactggtatgtcgagctggccaaggtgcagatcttcggcggtttgccgcacaccacggcg
gtgctcgcggcagtcctggacactctgctcaagctgctgcacccggtgatgccgttcgtc
accgagacgctgtggaagaccctcaccggtggtgagtcggcggtcatcgcggcgtggccg
caaccgtccggtttcgctccggatccggttgcggcacaacgcatcaccgacatgcagaag
ctcatcaccgaggtgcggcggttccgcagcgatcaggggctggccgaccggcagaaggtt
ccggcgcggttgtccgacatcgccgcggcgcagctttccgagcagctgcccgcgatcacg
tcgctggcgtggctgaccgaggccggagacgggttcacgccgtcggctgctgtcgaggtg
cggttgtcgcagaccactgtcgtggtcgaggtggacacgtcgggcaccgtcgacgtcgcc
gccgaacggcgccggctcgaaaaagacctggccgtcgcacaaaaggaaatggccaccacc
gccgccaagctcggcaacgacgcgttcctggccaaggcacccgccgaggtggtcgacaag
atccggggtcgccagcaggtggccaccgaggaggtcgaacgcatcaccgcgcgcctggcc
gggctcaaatga

DBGET integrated database retrieval system