KEGG   Mycobacterium dioxanotrophicus: BTO20_18205Help
Entry
BTO20_18205       CDS       T05102                                 

Definition
(GenBank) isoleucine--tRNA ligase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BTO20_18205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mdx01007]
    BTO20_18205
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mdx03016]
    BTO20_18205
Enzymes [BR:mdx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     BTO20_18205
Amino acid related enzymes [BR:mdx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BTO20_18205
Transfer RNA biogenesis [BR:mdx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BTO20_18205
 Prokaryotic type
   Other AARSs
    BTO20_18205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1e Terpene_synth_C
Motif
Other DBs
NCBI-ProteinID: ART70237
UniProt: A0A1Y0C558
Position
complement(3794097..3797255)
Genome map
AA seq 1052 aa AA seqDB search
MSAYPKPAAPNFPERELEVLDYWAGDDTFRASIARRDDAPEYVFYDGPPFANGLPHYGHL
LTGYVKDIVPRYRTMRGYKVERRFGWDTHGLPAELEVQRQLGIADKAQIEAMGIEKFNDA
CRASVLKYTDEWRAYVTRQARWVDFDNDYKTLDPTFMESVIWAFKQLWDKGLAYEGNRVL
PYCWNDETPLSNHELRMDDDVYQSRQDPAVTVGFSVTEGPLQGAHLLIWTTTPWTLPSNQ
AVAVNPDITYVLVQGSEGRRYVLAEARLAAYARELGEEPEVLGTYPGRDLVGMPYLPPFP
YFMDSPNAFRVLAADFVSTEDGTGIVHMAPAYGEDDKATADTADIVAVTPVDSKGRFDAS
VPDYVGQHVFEANSQIIRDLKNGDGSAGANGAVLLRHETYEHSYPHCWRCRNPLIYRAVS
SWFIKVTEFRDRMVELNKEITWYPEHVKDGQFGKWLSNARDWSVSRNRYWGSPIPVWKSD
DPAYPRIDVYGSLDELERDFGVRPTNLHRPYIDELTRPNPDDPTGKSTMRRIEDVFDVWF
DSGSMPYAQVHYPFENQAWFDGVGGAENQAGAEGADAHFPGDFIVEYIGQTRGWFYTMHV
LATALFDKPAFKTCVAHGIVLGNDGQKMSKSLRNYPDVSEVFDRDGSDAMRWFLMASPIL
RGGNLIVTEQGIREGVRQVLLPLWNAYSFLALYAPQKGTWRTDSTNVLDRYILAKLAQLR
DDLTASLDVCDISGACDELRQFTEALTNWYVRRSRSRFWEEDADAIDTLHTVLEVTSRLA
APLLPLATEVIWRGLTDERSVHLTDWPEADVLPKDPDLVAAMDQVREVCSVGSSLRKAKK
LRVRLPLPKLTVAVDNPDALAPFGDLIADELNVKAVDLTDDIDAYGKFELAVNARVAGPR
IGKDVQAAIKAVKAGEGVVNPDGTLTAGPVVLQPAEYTSKLVAADPEWTSALPDGAGLVV
LDGTVTEELEAEGWAKDRIRELQELRKTTGLEVSDRIAVQMAVPAEFAAWADTHRDLIAG
EILATSFEFVGTDTVLDGAAIGDGVRVAIAKV
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcctatcccaagcccgccgcaccgaattttccggagcgcgaacttgaggtgctg
gactactgggccggcgacgacactttccgggccagcatcgcgcgccgcgacgacgcaccg
gagtacgtcttctatgacggtccgccgttcgccaacggcctgccgcactacggccacctg
ctgaccggctacgtcaaggacatcgtgccgcggtaccgcactatgcgcggctacaaggtg
gagcgcaggttcggctgggacacccacggcctgcccgccgagctcgaggtccagcgccag
ttgggcatcgccgacaaggcgcagatcgaggcgatgggtatcgagaagttcaacgatgcc
tgccgtgcctcggtgctgaagtacaccgacgagtggcgcgcctacgtcacgcggcaggcc
cgctgggtggacttcgacaacgactacaagaccctggaccccaccttcatggagtcggtc
atctgggccttcaagcagctgtgggacaagggcctggcctacgagggcaaccgcgtgctg
ccgtactgctggaacgacgagaccccgttgtccaaccacgagctgcggatggacgacgac
gtctaccagagccgccaggatcctgcggtgaccgtcgggttctcggtgaccgaggggcca
ctgcagggcgcccacctgctgatctggacgacgacgccgtggaccttgccgtccaatcag
gccgtggccgtcaaccctgacatcacctacgtgctggtgcaaggctccgaggggcggcgg
tacgtcctcgcggaggcccggctggccgcctacgcacgcgagctgggtgaggagccggag
gtcctcggtacctatccgggccgggacctggtgggcatgccctatctgccgccgttccca
tatttcatggactcgcccaacgcatttcgggtgctcgccgcagacttcgtcagcaccgag
gacggtacgggcatcgtgcacatggcgcccgcctacggcgaggacgacaaggccacggca
gacaccgccgacatcgtcgccgtcacacccgtggactccaagggccggttcgacgcgtcg
gttcccgattacgtgggtcagcatgtgttcgaagccaattcgcagatcatccgggatctc
aagaacggtgacggatcagctggcgccaacggcgcggtcctcctgcggcacgagacctac
gagcactcctatccgcactgctggcggtgccgtaacccgttgatctaccgcgcggtgtcg
tcgtggttcatcaaggtgactgagttccgcgaccggatggtcgagctcaacaaggagatc
acctggtaccccgagcacgtcaaggacggtcagttcggcaagtggctgtccaatgcgcgt
gactggtcggtatcgcgaaaccgctactggggcagccctattccggtgtggaagtccgac
gatccggcgtatccgcggatcgacgtgtacggcagtctcgatgagctcgagcgtgacttc
ggagtacgcccgacgaacctgcaccggccctacatcgacgagctgacccggcccaacccc
gacgatccgaccggcaagtccaccatgcgccgcatcgaggacgtgttcgacgtgtggttc
gactcggggtccatgccgtatgcgcaggtgcactacccgttcgagaatcaggcctggttc
gacggtgtcggcggtgccgagaatcaagctggtgccgaaggtgccgacgcccacttcccg
ggcgatttcatcgtcgagtacatcggccagacccgcggctggttctacaccatgcacgtg
ttggccaccgcgctgttcgacaagccggcattcaaaacctgtgtggcacatgggatcgtg
ctcggcaacgacggccagaagatgagcaagtcgctgcgcaactatcccgacgtcagcgag
gtgttcgaccgcgacggctccgacgccatgcggtggttcctgatggcctcgccgatcctg
cggggcggcaacctcatcgtcaccgagcagggcatccgcgagggcgtgcgtcaggtgctg
ctaccgctgtggaacgcctacagtttcctggcgctctacgcgccgcagaagggaacgtgg
cgcaccgattcgacgaacgtcctggatcgctacatcctggccaagctggcgcagttgcgc
gacgatctgaccgcgtcgctggacgtctgcgacatctccggggcatgcgacgagctgcgg
cagttcaccgaagcgttgacgaactggtatgtgcgccggtcacgttcgcggttctgggag
gaggacgccgacgccatcgacacgctgcacaccgtgctcgaggtgaccagccggctcgcc
gcgccgctgctgccgctggccaccgaggtgatctggcgcgggttgaccgacgagcggtcg
gtgcacctgaccgactggccggaggccgacgtgctgccgaaggatcccgatctggtcgcg
gcgatggaccaggtgcgcgaggtgtgctcggtgggctcgtcgctgcgcaaggccaagaag
ctgcgggtgcgcctgccgctgccgaaactgaccgtggccgtggacaacccggatgcgctc
gcgccgttcggcgacctgatcgccgacgaattgaacgtcaaggcggttgacctcaccgac
gacatcgatgcctatggcaagttcgaactcgccgtcaacgcccgggtcgccggacctcgg
atcggcaaggacgttcaggccgcgatcaaggccgtcaaggcgggtgagggtgtggtcaat
cccgacggcaccctgaccgcgggcccggtggtgctgcaaccggccgaatacacctccaaa
ctcgttgcggcggacccggaatggacttcggcgctgcccgacggggccgggctggtggtg
ctcgacggcaccgtcaccgaggagctcgaagccgaaggctgggccaaggaccggatccgc
gagcttcaggagctgcgcaagacgacgggactggaggtctccgaccggatcgcggtgcag
atggcggtgcccgcggagtttgccgcgtgggccgacacccaccgcgacctcatcgccggc
gagatcttggccaccagtttcgaattcgtgggcacggatacggtgctggacggcgcggcg
atcggcgacggcgtgcgggtggcgatcgcgaaggtctga

DBGET integrated database retrieval system