KEGG   Mycobacterium dioxanotrophicus: BTO20_24365Help
Entry
BTO20_24365       CDS       T05102                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00360  Phenylalanine metabolism
mdx00362  Benzoate degradation
mdx00621  Dioxin degradation
mdx00622  Xylene degradation
mdx01100  Metabolic pathways
mdx01120  Microbial metabolism in diverse environments
mdx01220  Degradation of aromatic compounds
Module
mdx_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BTO20_24365
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTO20_24365
   00622 Xylene degradation
    BTO20_24365
   00621 Dioxin degradation
    BTO20_24365
Enzymes [BR:mdx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     BTO20_24365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: ART71263
UniProt: A0A1Y0C7R6
Position
5011564..5012586
Genome map
AA seq 340 aa AA seqDB search
MTRPVYISDVTLRDGMHAVRHQYRIDQAVRIAQALDAAGVDSIEVAHGDGLGGSSCIYGF
GAHTDLEWIEAVADTVTRAKVATLLLPGIGTVRNLTDAHHAGATVVRVATHCTEADLSAR
YIASARELGMDTAGFLMMSHMTTPNVLAEQARLMEGYGATCVYVVDSGGAMTMRDVAERV
SALRQTLSATTDIGIHAHHNLALGVANSITAVEHGAHRVDASLTGMGAGAGNAPLEVFVA
AISKLGASHGCDLHALQDAADDIVRPLQDRPVRVDRETLTLGYAGVYSSFLRHAESTAER
YGIDARTLLEEAGRRGMVGGQEDLLVDIALDLTTESAPAG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacccgccccgtgtacatcagcgatgtgacgctgcgcgatggcatgcacgcggtgcgt
catcagtaccgcatcgaccaggccgtgcggattgcgcaggccctcgacgccgccggggtc
gactcgatcgaggtggcccacggcgacgggctgggcggttcgagctgcatctacggcttc
ggcgcccacaccgatctggagtggatcgaagccgtcgccgacacggtgacccgggccaag
gtcgccaccttgctgttgccgggaatcgggaccgtccgaaatctgaccgacgcccaccac
gccggcgccaccgtggttcgggtcgccacccattgcaccgaagccgacctctccgcccgc
tacatcgcgtcggcccgcgaactcggcatggacaccgccggtttcctgatgatgagccac
atgacgacgccgaacgtgctggccgagcaggcccgattgatggagggctatggcgcgacg
tgtgtctacgtcgtcgactcggggggtgcgatgaccatgcgtgatgtcgccgaacgtgtc
agtgcgctacgccaaaccctctccgccacaactgatatcggtatccatgcgcaccacaac
ctggcactcggcgtggccaattccatcacggccgtggaacacggcgcgcaccgcgtggac
gcgtcgctcaccggcatgggggcgggtgcgggcaacgcaccccttgaggtgttcgtcgcc
gcgatcagcaagctcggcgcctcacacggctgcgacctgcacgcgttgcaggacgccgcc
gacgacatcgtgcgtcccttgcaagaccgcccggttcgagtggaccgggaaactctgact
ctcggttatgccggggtgtattcgagcttcctgcggcacgccgagtcgacggccgagcgc
tacggcatcgacgcacgcacgctgctcgaggaagccggccgtcgtggcatggtcggcggc
caggaggacctgctcgtcgacatcgcactggatctcacgacagaatccgccccggcgggg
tga

DBGET integrated database retrieval system