KEGG   Mycobacterium dioxanotrophicus: BTO20_26400Help
Entry
BTO20_26400       CDS       T05102                                 

Gene name
katE
Definition
(GenBank) catalase HPII
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00380  Tryptophan metabolism
mdx00630  Glyoxylate and dicarboxylate metabolism
mdx01110  Biosynthesis of secondary metabolites
mdx01130  Biosynthesis of antibiotics
mdx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BTO20_26400 (katE)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BTO20_26400 (katE)
Enzymes [BR:mdx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BTO20_26400 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel Catalase_C DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ART73910
UniProt: A0A1Y0CF74
Position
5442619..5444727
Genome map
AA seq 702 aa AA seqDB search
MNNTPNPKQQQLEGARVDNGKGYLTTQQGVRIDHTDDALTAGERGPTLLEDFHAREKVTH
FDHERIPERVVHARGAGAYGYFEPYDDGLADFTAAKFLTTPGLRTPVFVRFSTVAGSRGS
ADTVRDVRGFATKFYTEQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPHNEIPQAASA
HNTLWDFVSLQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFRLVNASGQGVFVKFHWKP
LLGVHSLIWEECQQIAGKDPDFNRRDLWEAIEAGHYPEWELGVQLIPESDEFDFPFDLLD
ATKIVPEERVPVLPVGRMVLDRNPDNFFAETEQVAFHTANLVPGIDFTNDPLLQFRNFSY
LDTQLIRLGGPNFAHLPVNRPIADVRNNQRDGYSQHTIAQGPTSYYKNTLGGGCPALADE
DVFRHYTERVDGHKIRRRAESFKDYYSQPRLFWDSMSAVEAEHIVAAFAFELGKVGPETG
IRPRVVEQLNLIDHDLAARVAAKLGLTAPAEVSIDVRHAPSPALSQLNAVPHTIDTRRIA
VLAAGGVDVRGIERAAAALRRLGATVDIISTVGGGTVWCDTGHELAVDLGINTTSSALYD
AVLVPGGAESVEQLTQDGSMIHFVSEAYKHLKPIAAFGAGIDVLQAAGVRTRVANGSGAV
SDDGVITSRTSGDDLDDAFIGALVGAVERHRVWDRVTDMIPA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaacaccccaaacccgaagcaacaacaactcgaaggcgcccgagtcgacaacggc
aaggggtatttgaccacccaacagggcgtgcggatcgaccacaccgatgacgccctgaca
gccggtgaacgcgggccgaccctgctggaagacttccacgccagggagaaggtgacccac
ttcgaccacgagcgcattccggaacgggtcgtgcacgccagaggtgctggtgcatatggc
tatttcgagccgtatgacgatggcctggcggatttcaccgcagcgaagttcctcaccaca
ccgggcttgcgaacgccggtgttcgtccggttctccaccgtggcaggctcacgcggctcg
gccgacaccgtccgtgacgttcgcgggttcgccacgaagttctataccgaacaaggcaac
tacgaccttgtcggcaacaacttccccgtcttcttcatccaggacggcatcaaattcccc
gacttcgtccacgcggtcaaacccgagccgcacaacgagattccgcaggccgcatcggcg
cacaacaccctgtgggatttcgtgtcgctgcagccggagacgctgcacgcgatcatgtgg
ttgatgtccgaccgcgcgcttccccgcagctaccggatgatgcaggggttcggcgtgcac
acgttccgcctcgtgaacgcctccggccaaggggttttcgtcaagttccactggaagccg
ctgctcggcgtgcattcgctcatatgggaggaatgccagcagatcgccggcaaggacccc
gatttcaaccgacgcgatctgtgggaggccatcgaggccgggcactatccggaatgggag
ctcggggtgcaactgattcccgagtccgacgaattcgacttccccttcgacttgctcgac
gccaccaagatcgttccggaggaacgggtgccggtgcttccggtgggacggatggtgctg
gatcgcaatccggacaactttttcgccgagaccgaacaggtggcgttccacacggccaac
ctggtgccgggaatcgatttcaccaacgatccgctgctgcagttccgcaacttctcgtac
ctcgacacgcagctcattcggttgggcggtccgaacttcgcccatcttcccgtcaaccgt
ccgatcgccgatgtccgcaacaaccagcgcgatggctacagccagcacacgatcgcccag
ggaccgacgagctactacaagaacaccctcggcggcggctgtcctgcccttgccgacgag
gatgtcttccggcactacaccgaacgcgtcgacggccacaagatccgccggcgcgcggag
agtttcaaggactactacagccaaccacggttgttctgggacagcatgtccgcggtcgag
gccgagcacattgtcgccgcgttcgcattcgaactcggcaaagtcgggcccgagaccggc
atacggccgcgggtggtcgaacaactcaacctgatcgaccacgatctcgccgcgcgggtc
gcggcgaagctgggcctgaccgcaccggcagaagtatccatcgacgtccgtcacgcaccg
tcacccgccttgtcccagctcaatgcggtcccgcacacgatagacacccgacgcatcgcc
gtcctggcggcaggcggggtcgatgtccgtgggatcgagcgcgcagctgcggcgctgcgc
cggctcggtgcgacggtcgacatcatcagcacggtcggcggcggcacggtgtggtgcgac
accggccacgaactcgccgtggacctgggcatcaacaccacctcgtcggccctctacgac
gcggtcctcgtacccggcggagcggaatccgtcgaacagctgacacaagacgggtcgatg
attcacttcgtgagcgaggcgtacaagcacctcaagcccatcgccgcattcggcgccggc
atcgatgtgctgcaggcggccggtgtgagaactcgggtggccaacggatccggagccgtg
tcggacgacggggtcatcacgtcgcgcacgagcggcgacgacctcgacgatgcgttcatc
ggcgcactcgtcggagcggtcgaacgtcatcgggtatgggaccgcgtgaccgacatgatt
cctgcctga

DBGET integrated database retrieval system