KEGG   Mycobacterium dioxanotrophicus: BTO20_27095Help
Entry
BTO20_27095       CDS       T05102                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00270  Cysteine and methionine metabolism
mdx00920  Sulfur metabolism
mdx01100  Metabolic pathways
mdx01110  Biosynthesis of secondary metabolites
mdx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BTO20_27095
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BTO20_27095
Enzymes [BR:mdx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     BTO20_27095
    2.3.1.46  homoserine O-succinyltransferase
     BTO20_27095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Esterase
Motif
Other DBs
NCBI-ProteinID: ART71716
UniProt: A0A1Y0C9I5
Position
5582538..5583680
Genome map
AA seq 380 aa AA seqDB search
MTITEIPTVSPDRPPAPLPAEGELGAVNIGTLRLENGAVLPDVTIAVQRWGELSPTRDNV
VVVLHALTGDSYVTGPAGPDHPTPGWWDGVAGPGAPIDTDRWCAISTNVLGGCRGSTGPG
SLAPDGKPWGSRFPQITIRDQVEADRAALAALGITKVAAVVGGSMGGARALEWLVGHPDE
VGAGLVLAVGARATADQIGTQSSQVAAIKTDPDWQGGDYYGTGREPVTGMEIARRFAHLT
YRGEEELDARFRNDAQGGEDPGSGGRYGVQSYLEYQGGKLAARFDPGTYVVLSDALSSHD
VGRGRGGVRAALRSCPVPVIVGGITSDRLYPIRLQEELAELLPGCRELDVVDSEYGHDGF
LVETEVVGKLVRRTLELIPR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcaccgagatccccaccgtgtcccccgaccgtccccccgccccgctgcccgcc
gaaggcgaactcggcgcggtgaacatcggcacactgcgcctggagaacggcgccgtcctg
cccgacgtcaccattgccgtgcagcgctggggcgagctgtcccccacccgcgacaacgtc
gtggtggtgctgcacgcactgaccggagactcctacgtcaccggcccggccggccccgac
catcccacccccggctggtgggacggtgtcgcaggccccggtgccccgatcgacaccgac
cgctggtgcgcgatctccaccaacgtgctcggcggctgccgcggttccaccggccccggt
tcgctggcccccgacggaaagccgtggggctcaaggtttccccagatcaccatccgcgac
caggtcgaggccgaccgggctgcgcttgcggcgctgggcatcaccaaggtcgcggcggtg
gtcggcggctcgatgggcggggcccgcgcactggagtggctggtgggccatcccgacgag
gtcggcgccggactggtgctcgcggtcggggcgcgcgcgaccgccgaccagatcggtacc
cagagcagccaggtcgcggccatcaagaccgatcccgactggcagggcggcgactactac
ggcaccggccgcgaaccggtgaccggtatggagatcgcccgacggttcgcgcatctgacc
taccgcggcgaagaggagctcgacgcccggttccgcaacgacgcccaaggcggcgaggat
cccggtagcggtggccgctacggggtgcagagctacctggagtaccagggcggcaagctc
gccgcccggttcgatcccggcacctacgtcgtgctctccgacgcactgtccagccacgac
gtcggccgcggccgcggcggggtgcgggccgcgctgcgcagttgcccggttccggtgatc
gtcggcgggatcacctccgaccggctctaccccatccgcctgcaggaggagctcgccgag
ctgctgcccggttgccgcgaactggatgtcgtggactcggagtacgggcacgacggattt
ctggtcgagaccgaggtggtcggcaagctggtgcgccggacactggagctgataccgagg
tga

DBGET integrated database retrieval system