KEGG   Mycobacterium dioxanotrophicus: BTO20_29220Help
Entry
BTO20_29220       CDS       T05102                                 

Definition
(GenBank) short-chain dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    BTO20_29220
Enzymes [BR:mdx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     BTO20_29220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N Shikimate_DH F420_oxidored Sacchrp_dh_NADP Epimerase Herpes_capsid ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ART73985
UniProt: A0A1Y0CGB4
Position
6036646..6037437
Genome map
AA seq 263 aa AA seqDB search
MILDRFRLDDKVAIVTGAGRGLGAAIAVAFAEAGADVVIASRTQSQLEDVAEQIRGIGRK
AHVVAADLAHPEATAELAGAATSAFGKLDIVVNNVGGTMPAPLVNTSTQALRDAFTFNVS
TAHALTAAAVPLMLEHSGGGSIINITSTMGRLAGRGFVAYGTAKAALAHYTRLAALDLCP
RIRVNAIAPGSILTSALDIVASNDALREPMEKVTPMRRLGDPEDIAAAAVYLASPAGSYL
TGKILEVDGGITYPNLDLPIPDL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgattctggacagattccgactcgacgacaaggttgcgatcgtcaccggagctggccgc
ggcctgggcgcggccatcgccgtggccttcgctgaagcaggcgccgacgtggtcatcgcg
tcccgcacacaatcccaactcgaggacgtggccgagcagattcgaggcatcggccgcaag
gcccacgtggtggccgccgacctcgcgcacccggaggccaccgccgaactcgcgggggcc
gcaacgagtgcgttcgggaaactagacatcgtcgtcaacaacgtcggcggcaccatgccc
gcaccgctcgtcaacacatcgacccaggccctgcgcgacgcgttcacgttcaatgtttcg
accgcgcacgcactcaccgcggccgcggtgccgctgatgctcgaacactcgggcggcggc
agcatcatcaacatcacctcgaccatgggacggctggccgggcgcggcttcgtcgcgtac
gggaccgccaaggccgccctggcgcactacacccggttggcggcgctcgacctgtgcccg
cgcatccgggtcaacgccatcgcgcccggctcgatcctcacctcggccctggacatcgtc
gcgagcaacgacgcgctgcgcgagccgatggagaaagtcacgccgatgcgccggctcggc
gatccggaggacatcgccgccgccgcagtctatttggcctcgcccgcgggcagctacctg
accggaaagatccttgaggtcgacggcggcatcacctacccgaacctcgatctgcccatc
cccgacctgtaa

DBGET integrated database retrieval system