KEGG   Mycobacterium dioxanotrophicus: BTO20_35715Help
Entry
BTO20_35715       CDS       T05102                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00361  Chlorocyclohexane and chlorobenzene degradation
mdx00625  Chloroalkane and chloroalkene degradation
mdx01100  Metabolic pathways
mdx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTO20_35715
   00361 Chlorocyclohexane and chlorobenzene degradation
    BTO20_35715
Enzymes [BR:mdx01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BTO20_35715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ART73183
UniProt: A0A1Y0CD49
Position
complement(7424831..7425526)
Genome map
AA seq 231 aa AA seqDB search
MKALAFDVFGTVVDWRSSIIAELAAFGNTRGLQRDWPAFADAWRAGYAPAMDRVRRGELP
WTRIDDLHRQILVSLLTEAGIEAGDDEVDHLNRAWHRLNPWPDAVAGLTRLKDRFVITTL
SNGNLSLLTSMAKHAGLPWDCVISAELFRHYKPDPEAYLGCAELLDVAPGELTLVAAHPS
DLRAAQAAGLGTAYVARPREHGPHGELHVVEPGEFDVVATDFLDLADQLGA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctctcgcgttcgacgtattcgggaccgtcgtcgactggcggtcatccatcatc
gccgaactcgcggcgttcgggaacacccgtgggctgcaacgggattggccggccttcgcc
gatgcctggcgggccggctacgccccggcgatggaccgggtgcggcgcggggagctgccg
tggacgaggatcgacgacctgcaccgccagatcctggtctcgctgctcaccgaggccggg
atcgaggccggggatgacgaggtcgatcacctcaaccgcgcgtggcaccggctgaacccg
tggcccgatgcggtcgccgggctgacccggctcaaggaccgcttcgtcatcaccacgctg
tccaacgggaacctgtccctactgaccagcatggccaaacatgctgggctgccgtgggat
tgcgtgatatcggctgagctgttccggcactacaaacccgatcccgaggcgtatctgggc
tgtgccgaactgctcgacgtcgcacccggcgagctgacgctcgtcgccgcacatccgtcg
gacctgcgggcggcccaggcggccgggttgggcacggcctacgtggcccggccccgagaa
catggcccgcacggcgagctccacgtcgtcgaaccgggcgagttcgatgtggtggcgacc
gattttctcgacctcgccgaccagctcggtgcgtag

DBGET integrated database retrieval system