KEGG   Methylobacterium extorquens AM1: Mex_1p0244Help
Entry
Mex_1p0244        CDS       T00921                                 

Definition
(GenBank) cytochrome c family protein
  KO
K08738  cytochrome c
Organism
mea  Methylobacterium extorquens AM1
Pathway
mea02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mea00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mex_1p0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACS38204
UniProt: C5APH8
Position
complement(264467..264988)
Genome map
AA seq 173 aa AA seqDB search
MTLVHVIERVTRAFRLPPLSQPVMLLALAFLVTACSDDSQERRRSLGDAPSFGDFMRVAD
AGRGARLFGQCAACHTVRMGAGDRNGPGLYDVVGKPVASRSRRFGYTGALRSAGGVWTPE
RLNAWLAAPAKFAPGTSMSFRGVPDPLDRADIVAYMQAQSVEAGGAEALSSRP
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
ttgacgttggttcacgtgatcgaacgggtgacgcgcgccttccgtcttcccccactcagc
cagcccgtcatgctgctggcgctggccttcctcgtcacagcctgctcagatgatagccag
gagcgtcgccgttccttgggcgacgccccgagcttcggcgacttcatgcgggtggccgac
gcgggtcggggcgcccgcttgtttggccagtgcgccgcctgtcacacggtcaggatggga
gccggcgaccgaaacggacccggtctctacgacgtggttggcaagcccgttgcgagcagg
agccgacgcttcggctacacaggggccctccggtcggcgggcggcgtctggacgccggag
aggttgaacgcttggcttgccgctcctgcgaagttcgcgccgggcaccagtatgagtttt
cgcggagttcccgacccgctcgaccgggcggacatcgttgcatatatgcaagcgcagtcg
gttgaggccggaggtgctgaggcgctctcctcgcggccttga

DBGET integrated database retrieval system