KEGG   Methylobacterium extorquens AM1: Mex_1p0559Help
Entry
Mex_1p0559        CDS       T00921                                 

Definition
(GenBank) putative uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mea  Methylobacterium extorquens AM1
Pathway
mea00860  Porphyrin and chlorophyll metabolism
mea01100  Metabolic pathways
mea01110  Biosynthesis of secondary metabolites
mea01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mex_1p0559
Enzymes [BR:mea01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mex_1p0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACS38498
UniProt: C5AUA8
Position
582940..583650
Genome map
AA seq 236 aa AA seqDB search
MRIWVSRPEPGASRTARRLAELGHAALVAPVLRIAPSDGPPPTGRFDGLILTSANAAAPL
AAAGLPEAPVFAVGTRTAERANRAGLRSVHCADGDAVSLARLVAAHVRPGGTLLHAAGED
RKAEPAASLTAAGYRVTTWTAYAALAETTLPAPVVQGLLGRDDAPLAAALHFSRRSAEIA
VHLSGKAGLSGAFRALAHYCLSPDVALGLVELGVAAHFVAARPSEEALLAGLAASD
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcggatctgggtgtcgcggcccgagccgggcgcgagccgcacggcacggcggctggcc
gagctcggccatgccgcgttggtggcgcctgtgctgcggatcgcgccgagcgacgggccg
ccgcccaccggccggttcgacgggctgatcctgacgagcgccaacgccgccgcgccgctc
gccgcagccggtcttcccgaggcaccggtcttcgccgtcggcacccgcaccgccgagcgg
gcgaaccgggcgggcctgcgctccgtgcactgcgccgacggagacgccgtcagcctggcc
cggctcgtcgcagcccatgtgcggccgggcggcactctcctccacgcggccggcgaggac
cgcaaggccgagcccgccgcgagcctcacggctgcgggctaccgcgtcacgacctggacc
gcctacgcggctctggccgagacgaccctgccggcgccggtggtgcaggggctgttgggc
cgggacgacgcgccgctcgccgcggccctgcatttttcgcgacgaagcgccgaaatcgcg
gtgcatttgtccggcaaagccggtctgagcggagcgtttcgggcgctggcgcattactgc
ctgtctccggacgtggccttgggactggtcgagctcggcgtcgcggcccattttgtagcg
gcgcgcccgagcgaggaagctctccttgccggtctcgcggcttcggactga

DBGET integrated database retrieval system