KEGG   Methylobacterium extorquens AM1: Mex_1p2470Help
Entry
Mex_1p2470        CDS       T00921                                 

Gene name
bchI
Definition
(GenBank) Mg chelatase subunit Bchl, participate to introduce Mg in bacteriochlorophyl with BchH and BchD
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mea  Methylobacterium extorquens AM1
Pathway
mea00860  Porphyrin and chlorophyll metabolism
mea01100  Metabolic pathways
mea01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mex_1p2470 (bchI)
Enzymes [BR:mea01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mex_1p2470 (bchI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_16 AAA_22 MCM AAA_29 DUF815 AAA AAA_18 FtsK_SpoIIIE AAA_30
Motif
Other DBs
NCBI-ProteinID: ACS40249
UniProt: C5ARE0
Position
2594692..2595705
Genome map
AA seq 337 aa AA seqDB search
MPAFPFTAIVAQEEMKRALLIAAVDPSVGGVLVFGDRGTGKSTAVRALAALLPKIRAVAG
CPYSCSPDSPAEACPHCARGRGKSHQIPVPVVDLPLGATEDRVVGALDLERALTKGEKAF
EPGLLARANRGFLYIDEANLLEDHLVDLLLDVAASGVNTVEREGLSLRHPARFVLVGSGN
PEEGELRPQLLDRFGLACEVTTPTDIATRIEVVRRRDAYERDGEAFCAAQGKAEKALQKT
ILAARERLGSVSVPDAVLENAARLCLALGTDGLRGELTLMRTARALAALEGADIVSVAHL
SQVAPSALRHRLRRNPLDESGSTARVARAVEEVLGAG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgcctttcccttcaccgccatcgtcgcccaggaggagatgaagcgggcgctgctg
atcgcggcggtcgatccgtcggtcggcggtgtcctcgtcttcggtgaccggggtaccggc
aagtccacggcggtgcgggcgctcgcggcgctgctgccgaagatccgggcggtcgccggc
tgtccctattcctgctcgcccgacagtccggccgaggcctgcccgcattgcgcgcggggg
cggggaaagagtcaccagatcccggtgccggtggtcgatctgccgctcggcgccaccgaa
gaccgggtggtcggcgcactcgatctggagcgggcgctgacgaagggggaaaaggcgttc
gagccgggcctgttggcgcgagccaaccgcggcttcctctacatcgacgaggcgaacctg
ctcgaggaccatctcgtggacctcctgctcgacgtggcggcgtccggggtcaacaccgtc
gagcgcgagggcctttcgctgcgccatccggcccgcttcgtcctcgtcggcagcggcaac
ccggaggagggggaactgcgtccgcagcttctcgaccgcttcggcctcgcctgcgaagtg
acgacgccgaccgacatcgccacgcgcatcgaggtggtgcggcggcgcgacgcctacgag
cgcgacggcgaggcgttctgtgccgcgcaagggaaggcggaaaaagcgctccagaagacg
attctcgcggcccgcgagcgtctcggcagcgtgagcgtgcccgatgcggttctggagaac
gcagcccggctctgcctcgcgctcggcaccgacggcctgcgcggcgaactcacgctgatg
cgcacggcccgggcgctcgccgccctcgaaggtgcggacatcgtctcggtcgcacatctc
agccaggtggcgccgagcgcgcttcgtcaccgcctacgccgcaacccgctcgacgagtcg
ggctccacggcgcgcgtggcgcgggccgtggaggaggtgctgggagccgggtga

DBGET integrated database retrieval system