KEGG   Methylobacterium extorquens AM1: Mex_1p3455Help
Entry
Mex_1p3455        CDS       T00921                                 

Definition
(GenBank) putative 3-ketoacyl-CoA thiolase (Fatty oxidation complex beta subunit) (Beta-ketothiolase) (Acetyl-CoA acyltransferase) (fadA-like)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mea  Methylobacterium extorquens AM1
Pathway
mea00071  Fatty acid degradation
mea00072  Synthesis and degradation of ketone bodies
mea00280  Valine, leucine and isoleucine degradation
mea00310  Lysine degradation
mea00362  Benzoate degradation
mea00380  Tryptophan metabolism
mea00620  Pyruvate metabolism
mea00630  Glyoxylate and dicarboxylate metabolism
mea00640  Propanoate metabolism
mea00650  Butanoate metabolism
mea00900  Terpenoid backbone biosynthesis
mea01100  Metabolic pathways
mea01110  Biosynthesis of secondary metabolites
mea01120  Microbial metabolism in diverse environments
mea01130  Biosynthesis of antibiotics
mea01200  Carbon metabolism
mea01212  Fatty acid metabolism
mea02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mex_1p3455
   00630 Glyoxylate and dicarboxylate metabolism
    Mex_1p3455
   00640 Propanoate metabolism
    Mex_1p3455
   00650 Butanoate metabolism
    Mex_1p3455
  Lipid metabolism
   00071 Fatty acid degradation
    Mex_1p3455
   00072 Synthesis and degradation of ketone bodies
    Mex_1p3455
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mex_1p3455
   00310 Lysine degradation
    Mex_1p3455
   00380 Tryptophan metabolism
    Mex_1p3455
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mex_1p3455
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mex_1p3455
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mex_1p3455
Enzymes [BR:mea01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mex_1p3455
Exosome [BR:mea04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mex_1p3455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACS41192
UniProt: C5AY93
Position
complement(3593551..3594759)
Genome map
AA seq 402 aa AA seqDB search
MPEAYIYDHVRTPRGRGKPDGSLHEVTALRLAETALRALKDRNGLDTRQVDDVVLGCVDP
VGEAGGDIARAAALVADYGTHVPGVQINRFCASGLDAINFAAAQVMAGQHDLTVGGGVES
MSRVGLGASGGAWPVDPAIAVKSYFMPQGVSADLIATKYGFSRDDCDAYAVESQKRSAQS
WGEGLFKNSVVPVRDINGITLLDRDEHMRPTTDMQSLASLKPSFVQMGQMGGFDAVAVDA
HPDVEAVHHVHHAGNSSGIVDGAAAVLIGSREAGDAAGLRPRARIRAFANIGSDPALMLT
GPVDVTKKVLARAGMSLSDIDLFEINEAFASVVLRFHQAFDLDPAKVNVNGGAIAMGHPL
GATGAMILGTVLDELERTGKERALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggcctacatctacgatcacgtccgcaccccccgcggccgcggcaagccggac
ggttcgctgcacgaggtgacggcgttgcgcctcgccgagacggcgttgcgcgcgctcaag
gaccgcaacggcctcgacacgcggcaggtggacgacgtggtgctgggctgcgtcgatccg
gtcggcgaggccggcggcgacatcgcccgcgccgccgcgctcgtggccgattacggcacc
cacgtgcccggcgtgcagatcaaccgcttctgtgcctcgggcctcgacgccatcaacttc
gccgcggcgcaggtcatggccggccagcacgatctcaccgtcggcggcggcgtcgaatcg
atgagccgcgtcggcctcggcgcctcgggcggcgcctggccggtcgatccggcgatcgcg
gtcaaatcctacttcatgccgcagggcgtctcggccgacctcattgccaccaagtacggg
ttcagccgcgacgattgcgatgcctacgccgtcgagtcgcagaagcgctcggcccaatcc
tggggcgagggcctgttcaagaactccgtcgtgccggtgcgggatatcaacggcatcacc
ctgctcgaccgtgacgagcacatgcggccgacgaccgacatgcagtcgctggcgagcctg
aaaccgtccttcgtgcagatgggccagatgggcggcttcgacgccgtggccgtcgatgcc
cacccggatgtcgaggcggtccatcacgtccaccatgccggcaactcgtcgggcatcgtg
gatggcgcggcggcggtgctgatcggctcgcgcgaggccggcgacgccgcgggcctgcgg
ccccgcgcccgcatccgggcgttcgccaatatcggctccgatccggcgctgatgctgacc
ggcccggtcgatgtcacgaagaaggtgctggcgcgggctggcatgagcctgtccgacatc
gacctgttcgagatcaacgaggccttcgcctcggtggtcctgcgcttccatcaggccttc
gacctcgacccggcgaaggtgaacgtcaacggcggcgccatcgccatgggccatccgctg
ggtgccacgggcgcgatgatcctcggcaccgtgctcgacgagctggagcgcaccggtaag
gagcgggcgctcgtcaccctgtgcatcggtgccggcatgggcaccgccacgatcatcgag
cgggtgtga

DBGET integrated database retrieval system