KEGG   Methylobacterium extorquens AM1: Mex_1p3700Help
Entry
Mex_1p3700        CDS       T00921                                 

Gene name
phaA
Definition
(GenBank) beta-ketothiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mea  Methylobacterium extorquens AM1
Pathway
mea00071  Fatty acid degradation
mea00072  Synthesis and degradation of ketone bodies
mea00280  Valine, leucine and isoleucine degradation
mea00310  Lysine degradation
mea00362  Benzoate degradation
mea00380  Tryptophan metabolism
mea00620  Pyruvate metabolism
mea00630  Glyoxylate and dicarboxylate metabolism
mea00640  Propanoate metabolism
mea00650  Butanoate metabolism
mea00900  Terpenoid backbone biosynthesis
mea01100  Metabolic pathways
mea01110  Biosynthesis of secondary metabolites
mea01120  Microbial metabolism in diverse environments
mea01130  Biosynthesis of antibiotics
mea01200  Carbon metabolism
mea01212  Fatty acid metabolism
mea02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mex_1p3700 (phaA)
   00630 Glyoxylate and dicarboxylate metabolism
    Mex_1p3700 (phaA)
   00640 Propanoate metabolism
    Mex_1p3700 (phaA)
   00650 Butanoate metabolism
    Mex_1p3700 (phaA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mex_1p3700 (phaA)
   00072 Synthesis and degradation of ketone bodies
    Mex_1p3700 (phaA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mex_1p3700 (phaA)
   00310 Lysine degradation
    Mex_1p3700 (phaA)
   00380 Tryptophan metabolism
    Mex_1p3700 (phaA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mex_1p3700 (phaA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mex_1p3700 (phaA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mex_1p3700 (phaA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mea04147]
    Mex_1p3700 (phaA)
Enzymes [BR:mea01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mex_1p3700 (phaA)
Exosome [BR:mea04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mex_1p3700 (phaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt B12-binding SpoVAD CMD
Motif
Other DBs
NCBI-ProteinID: ACS41411
UniProt: C5AZN7
Position
3846006..3847190
Genome map
AA seq 394 aa AA seqDB search
MAASEDIVIVGAARTPVGSFAGAFGSVPAHELGATAIKAALERAGVSPDDVDEVIFGQVL
TAAAGQNPARQAAIAAGIPEKATAWGLNQVCGSGLRTVAVGMQQIANGDAKVIVAGGQES
MSLSPHAQYLRGGQKMGDLKLVDTMIKDGLWDAFNGYHMGQTAENVAQAFQLTREQQDQF
AVRSQNKAEAARKEGRFKEEIVPVTVKGRKGDTVVDTDEYIRDGATVEAMAKLKPAFAKD
GTVTAANASGLNDGAAALVLMSASEAERRGITPLARIVSWATAGVDPKVMGTGPIPASRK
ALEKAGWKPADLDLIEANEAFAAQALAVNKDMGWDDEKVNVNGGAIAIGHPIGASGARVL
ITLLHELKRRDAKKGLATLCIGGGMGVAMCVERV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcagccagtgaagatatcgtcattgtcggtgcggcgcgtacgcccgtcggatcgttc
gccggtgccttcggttccgtgccggcccacgaactcggcgccacggcgatcaaggccgca
ctggagcgcgcaggcgtttcgccggacgacgtggacgaggtgatcttcggccaggtgctc
accgctgccgccgggcagaacccggcccgtcaggccgccatcgccgcgggcatccccgag
aaggcgaccgcctggggcctcaatcaggtctgcggctcgggcctgcgcaccgtcgcggtc
ggcatgcagcagatcgccaacggcgacgccaaggtgatcgtggccggcggccaggaatcg
atgtcgctcagcccgcacgcccagtatctgcgcggcggccagaagatgggcgatctcaag
ctcgtcgacaccatgatcaaggacggcctgtgggacgccttcaacggctaccacatgggc
cagaccgccgagaacgtcgcccaggccttccagctcacccgcgaacagcaggaccagttc
gcggtccgctcgcagaacaaggccgaggccgcccgcaaggaaggccgcttcaaggaagag
atcgtccccgtcaccgtgaagggccgcaagggcgacacggtcgtcgacaccgacgagtac
atccgtgacggcgccaccgtcgaggcgatggccaagctcaagcccgccttcgccaaggac
ggcaccgtgaccgcggccaacgcctcaggcctcaacgacggcgccgccgcgctggtgctg
atgtcggcctccgaggccgagcgccggggcatcacgccgctcgcccggatcgtgtcctgg
gcgaccgcgggcgtcgatcccaaggtgatgggcacgggcccgatcccggcctcgcgcaag
gccctggagaaggccggctggaagcccgccgacctcgacctgatcgaggcgaacgaggct
ttcgccgcccaggcgctggccgtgaacaaggacatgggctgggacgacgagaaggtgaac
gtcaatggcggcgccatcgccatcggccacccgatcggtgcctccggcgcccgcgttctc
atcaccctgttgcacgagctgaagcgccgcgacgctaagaagggcctcgccacgctctgc
atcggcggcggcatgggtgtcgccatgtgtgtcgagcgggtctga

DBGET integrated database retrieval system