KEGG   Methylorubrum extorquens AM1: Mex_1p4568Help
Entry
Mex_1p4568        CDS       T00921                                 

Definition
(GenBank) putative Acetyl-hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
mea  Methylorubrum extorquens AM1
Pathway
mea00903  Limonene and pinene degradation
mea00930  Caprolactam degradation
mea01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mea00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mex_1p4568
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Mex_1p4568
Enzymes [BR:mea01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     Mex_1p4568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Hydrolase_4 Say1_Mug180 DLH Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: ACS42198
UniProt: C5AQD8
Position
complement(4683463..4684419)
Genome map
AA seq 318 aa AA seqDB search
MTMASLRAHLYDLTIRLAVKGRLGGTHDVYAIRRAFEGARFPTPAGVAFTPGEVGGVPGE
WAEAAGAKTEGTKTEGTRADGERPTLLYCHGGGFIACSAQLYRPVTGRFARAGFRVFTPD
YRLAPEHPFPAAVEDCTGVWTALAEAGPAVVAGDSAGGSLALTTIIEARRLGLTPPVAAA
LFSPATDLIGRSASFRTNGRRDAMFRPEALMRLVPAYLAGADPADPRASPIEADLSGFPP
LLIHVGVREILRDDSLRLAEKAKAAGVPVELTVFPVVAHAWQLAESFLPEARRSLDEAAT
FLHRALKAPPHPEAEVAA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatggccagcctgcgcgcccacctctacgatctcaccatccgcctcgcggtgaag
gggcgactcggcggcacccacgatgtctatgcgatccgccgcgccttcgagggcgcccgg
ttcccgacgccggccggcgtcgccttcacccccggcgaggtcggcggcgtgcccggcgag
tgggcggaggccgcaggggcgaagacggaagggacgaagacggaagggacccgcgcggac
ggcgagcgcccaaccctgctctattgccacggcggcggcttcattgcctgctcggcgcaa
ttgtaccgcccagtcaccggccgcttcgctcgagccggcttccgggtgttcacgccggat
taccggttggcgccggagcacccctttcccgcggcggtcgaggattgcacgggtgtctgg
accgcgctcgcggaggcgggcccggcggtcgtcgccggggattccgcgggcggcagcctg
gcgctcaccacgatcatcgaggcgcgccgcctcggcctgaccccgcccgtggcggcggcc
ctgttctcgccggccaccgacctgatcggccgcagcgcctcgttccgcacgaatgggcgg
cgcgacgcgatgttccgccccgaggcgctgatgcggctggttccggcctacctcgccggg
gccgaccctgccgacccgcgcgcctcgccgatcgaggcggatttgtccgggtttccgccg
ctcctgatccatgtcggcgtccgcgagatcctgcgcgacgattccctgcgcctcgccgag
aaggcaaaggccgcgggcgtgccggtcgaactcacggtgtttcccgtggtggcgcatgct
tggcagctcgccgagagctttctgcccgaggcacgccgctccctcgacgaggccgcgacc
ttcctgcaccgcgccctgaaagcgcccccccatcctgaggcggaggtcgccgcgtga

DBGET integrated database retrieval system