KEGG   Methylobacterium extorquens AM1: Mex_1p5121Help
Entry
Mex_1p5121        CDS       T00921                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mea  Methylobacterium extorquens AM1
Pathway
mea00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mea01100  Metabolic pathways
mea01110  Biosynthesis of secondary metabolites
mea01130  Biosynthesis of antibiotics
mea01230  Biosynthesis of amino acids
Module
mea_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mex_1p5121 (trpC)
Enzymes [BR:mea01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mex_1p5121 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACS42725
UniProt: C5AU26
Position
5275136..5275993
Genome map
AA seq 285 aa AA seqDB search
MDDIVADVTVGPATSTPERASVLARIEAYKRREIAEAKLRLPLAKLEKQVAKADPPRGFA
DAIARHIAEGRPALIAEIKKASPSKGLIRADFDPKTLAKAYAKGGATCLSVLTDTPSFQG
APDFLIEARAACDLPVLRKDFMFEPYQVYEARAWGADCILVIMACLDDAEAAAITETAHD
LGMDVLVEVHDAQELERALPLGTRLVGVNNRNLKTFEVSFETAITLKPGIPADRIAVAES
GIGGHADVLRLKQHGLNTVLVGESLMRQDDVTAATRSLLFGEQGR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggacgacatcgtggccgacgtgaccgtcgggcctgccacctcgaccccggagcgggcg
agcgtgctggcccggatcgaggcctataagcgtcgcgagatcgccgaggcgaagctgcgt
ctgccgctggccaagctggaaaagcaggtcgccaaagccgacccgccccgcggctttgct
gacgccatcgcccggcatatcgcggaaggccgtccggccctgatcgccgagatcaagaag
gcctccccctccaaggggctgatccgcgccgatttcgacccgaagacgctggccaaggcc
tacgcaaagggcggcgccacctgcctttcggtgctgaccgacacgccctccttccagggc
gcaccggacttcctgatcgaggcgcgggcggcttgcgacctgccggtcctgcgaaaagac
ttcatgttcgagccgtatcaggtctacgaggcccgcgcctggggcgccgattgcatcctc
gtcatcatggcctgcctcgatgacgcggaggccgccgccatcaccgagaccgcgcacgat
ctcggcatggacgtgctggtcgaggtccacgacgcgcaggaactggagcgggccctgccg
ctcggcacccgtctggtcggcgtcaacaaccgcaacctcaagaccttcgaggtctccttc
gagaccgcgatcaccctgaagcccggtatcccggccgaccggatcgcggtggccgagagc
ggcatcggcggacatgccgacgtgctgcggctgaagcagcacgggctcaacaccgtcctc
gttggcgagagcctgatgcggcaggacgacgtgaccgcggcgacgcgctccctgctgttc
ggggagcagggccggtga

DBGET integrated database retrieval system