KEGG   Candidatus Methanoplasma termitum: Mpt1_c01650Help
Entry
Mpt1_c01650       CDS       T03540                                 

Definition
(GenBank) digeranylgeranylglycerophospholipid reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
mear  Candidatus Methanoplasma termitum
Pathway
mear00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mear00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mpt1_c01650
Enzymes [BR:mear01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     Mpt1_c01650
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     Mpt1_c01650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Trp_halogenase FAD_binding_2 FAD_oxidored Pyr_redox_2 DAO HI0933_like Thi4 NAD_binding_8 GIDA Lycopene_cycl Pyr_redox Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AIZ56066
UniProt: A0A0A7LEX9
Position
179264..180454
Genome map
AA seq 396 aa AA seqDB search
MKIYRCDVVVVGGGPGGSMAAKFCAQGGLDTIMIEKKAEIGAPLRCAEGVSKKWLEEVGI
EPDPTWICADMVGAVIRSPSGYEFKLDESQAGSEVGYVLERHLFDKALARDAVAAGARIM
MRTSCTDVIKENGKLIGIKCKSMGEKIEIHAKAIVAADGFESQVGRWAGIETKLDLNDIC
SCLQYRMVNADIDPEYCEFDIGMKIAPGGYLWIFPKGNGVANVGIGVMGKLCKNADAKKY
LDKFIAEDPRFKNSQAVEVVAGMVSTCPGLDCAVADNIILVGDAARIIDPITGGGICHAC
RTGMYAGQVLTECAKTGDFSKKALMPYEKMWRDRMEDKLYRNWMAKERLAELDDDTIDEL
VKLISGSDIKEVNVYNLLKVIKERFPKVVEGFEDLI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctacagatgcgacgtggttgtcgtcgggggaggccccggcggaagcatggct
gcaaagttctgtgcacagggcggtctcgatacgatcatgatcgaaaagaaggccgagata
ggggcaccgctgagatgtgccgaaggcgtgtccaaaaaatggctggaagaggtaggtatc
gaaccggacccaacatggatatgcgcagacatggtcggtgctgtgataaggtcgcccagc
ggatacgagttcaaacttgacgagagccaagcgggttccgaggtcggttatgtgctggaa
aggcacctcttcgacaaagcactcgcaagggacgccgttgctgccggtgcgaggataatg
atgcgcacgtcttgcactgatgtgataaaagagaacggaaagctcatcgggataaaatgt
aagagcatgggagagaagatagagatacacgccaaagccatagttgcggcagacggattc
gaatcccaagtaggcagatgggccgggatcgaaacgaaactggatctcaacgatatctgc
tcatgcctgcagtacagaatggtcaatgcagatatcgatccggaatactgtgagttcgac
ataggaatgaagatagctccaggcggatacctttggatattccccaagggaaacggtgtc
gccaatgtcggtatcggggtcatggggaaattgtgcaagaatgcagatgcaaagaagtat
ctggacaaattcatcgcggaggatccgagattcaagaacagtcaggcggtagaggtagtg
gcaggcatggtctctacctgtcccggactcgactgtgccgttgcagataatataatactt
gtgggcgatgcggcgaggataatcgacccaataaccggcggcgggatctgccatgcgtgc
agaacaggaatgtatgccggtcaggtcctgacggaatgcgcaaagaccggggatttctcc
aagaaagcgctgatgccatacgagaagatgtggcgcgataggatggaggataaactctac
aggaactggatggctaaggaaaggcttgcagagcttgatgacgacaccatcgatgagctt
gtaaagctgatctccggatcggatatcaaagaggtcaatgtctacaatcttctgaaagta
ataaaagagagattccctaaggtcgtcgaaggtttcgaagatctaatttaa

DBGET integrated database retrieval system